Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human KLK3 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P07288
Molecular weight:
26.92 kDa

205.00

20ug + 205 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human KLK3 Recombinant Protein

Product name Human KLK3 Recombinant Protein
Uniprot ID P07288
Uniprot link http://www.uniprot.org/uniprot/P07288
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Molecular weight 26.92 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P07288
Aliases /Synonyms Kallikrein 3,KLK3, APS, KLK2A1, PSA, HK3, KLKB1, Seminin, Prostate Specific Antigen, Kallikrein-Related Peptidase 3, Semenogelase, g-Seminoprotein, P-30 Antigen, Plasma kallikrein
Reference PX-P3045
Note For research use only
Molecular Constructor
Partial Yes
Product name Human KLK3 Recombinant Protein
Uniprot ID P07288
Uniprot link http://www.uniprot.org/uniprot/P07288
Origin species Homo sapiens (Human)
Expression system Procaryotic expression
Sequence IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Molecular weight 26.92 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P07288
Aliases /Synonyms Kallikrein 3,KLK3, APS, KLK2A1, PSA, HK3, KLKB1, Seminin, Prostate Specific Antigen, Kallikrein-Related Peptidase 3, Semenogelase, g-Seminoprotein, P-30 Antigen, Plasma kallikrein
Reference PX-P3045
Note For research use only
Molecular Constructor
Partial Yes
Product name Human KLK3 Recombinant Protein
Uniprot ID P07288
Uniprot link http://www.uniprot.org/uniprot/P07288
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Molecular weight 26.92 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P07288
Aliases /Synonyms Kallikrein 3,KLK3, APS, KLK2A1, PSA, HK3, KLKB1, Seminin, Prostate Specific Antigen, Kallikrein-Related Peptidase 3, Semenogelase, g-Seminoprotein, P-30 Antigen, Plasma kallikrein
Reference PX-P3045
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human KLK3 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products