Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) ASFV EP153R recombinant protein

Host species:
Mammalian cells
Origin species:
African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Uniprot ID:
P0CA64
Molecular weight:
41.38 kDa

Original price was: €360.00.Current price is: €277.00.

50ug 23% OFF + 277 loyalty points
Asn58–Lys161 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) ASFV EP153R  recombinant protein

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) ASFV EP153R recombinant protein

Product name PX-P6425-100
Uniprot ID P0CA64
Origin species African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Expression system Eukaryotic expression
Raw Antigen Sequence NQKDKTFYCPKDWVGYNNVCYYFGNDEKNYNNASNYCKQLNSTLTNNNTNLVNLTKTLNLTKTYNHESNYWVNYSLIKNESVLLRNSGYYKKQKHVSLLYICSK
Molecular weight 41.38 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn58-Lys161
Aliases /Synonyms pEP153R, Mal-065, African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)Lectin-like protein EP153R,
Reference PX-P6425
Molecular Constructor
Asn58–Lys161 Fc
Product name PX-P6425-1MG
Uniprot ID P0CA64
Origin species African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Expression system Eukaryotic expression
Raw Antigen Sequence NQKDKTFYCPKDWVGYNNVCYYFGNDEKNYNNASNYCKQLNSTLTNNNTNLVNLTKTLNLTKTYNHESNYWVNYSLIKNESVLLRNSGYYKKQKHVSLLYICSK
Molecular weight 41.38 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn58-Lys161
Aliases /Synonyms pEP153R, Mal-065, African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)Lectin-like protein EP153R,
Reference PX-P6425
Molecular Constructor
Asn58–Lys161 Fc
Product name PX-P6425-50
Uniprot ID P0CA64
Origin species African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Expression system Eukaryotic expression
Raw Antigen Sequence NQKDKTFYCPKDWVGYNNVCYYFGNDEKNYNNASNYCKQLNSTLTNNNTNLVNLTKTLNLTKTYNHESNYWVNYSLIKNESVLLRNSGYYKKQKHVSLLYICSK
Molecular weight 41.38 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn58-Lys161
Aliases /Synonyms pEP153R, Mal-065, African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)Lectin-like protein EP153R,
Reference PX-P6425
Molecular Constructor
Asn58–Lys161 Fc

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) ASFV EP153R  recombinant protein

There are no reviews yet.

Be the first to review “African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) ASFV EP153R recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products