Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Afelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

  • PX-TA1088-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
F(ab')2-G3-kappa

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Afelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Product name Afelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Source CAS 156227-98-4
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Afelimomab,MAK-195F,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1088
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype F(ab')2-G3-kappa
Clonality Monoclonal Antibody
Product name Afelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Source CAS 156227-98-4
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Afelimomab,MAK-195F,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1088
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype F(ab')2-G3-kappa
Clonality Monoclonal Antibody
Product name PX-TA1088-50
Uniprot ID P01375
Source CAS 156227-98-4
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Afelimomab,MAK-195F,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1088
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype F(ab')2-G3-kappa
Clonality Monoclonal Antibody

Title: Understanding Afelimomab Biosimilar: An Anti-TNFSF2 Antibody for Treating TNF-alpha Related Diseases

Introduction:

Afelimomab Biosimilar, also known as anti-TNFSF2, TNF-alpha, TNFA mAb, is a monoclonal antibody that specifically targets TNF-alpha, a cytokine involved in various inflammatory and autoimmune diseases. This biosimilar is a highly effective therapeutic option for patients suffering from TNF-alpha related diseases, as it mimics the action of the endogenous antibody and helps in regulating the immune response. In this article, we will delve into the structure, activity, and applications of Afelimomab Biosimilar in the field of medicine.

Structure of Afelimomab Biosimilar:

Afelimomab Biosimilar is a recombinant, fully humanized monoclonal antibody that is produced using advanced biotechnology techniques. It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding sites located at the tips of the arms. These binding sites are specific for TNF-alpha, allowing the antibody to bind and neutralize the cytokine.

Activity of Afelimomab Biosimilar:

The primary function of Afelimomab Biosimilar is to inhibit the activity of TNF-alpha. TNF-alpha is a pro-inflammatory cytokine that is involved in various physiological processes, including immune response, cell proliferation, and apoptosis. However, excessive production of TNF-alpha can lead to chronic inflammation and tissue damage, resulting in diseases such as rheumatoid arthritis, psoriasis, and Crohn’s disease.

Afelimomab Biosimilar works by binding to TNF-alpha and preventing it from binding to its receptors on the surface of immune cells. This, in turn, inhibits the downstream signaling pathways that lead to inflammation and tissue damage. Additionally, the antibody also promotes the clearance of TNF-alpha from the body, further reducing its levels and activity.

Applications of Afelimomab Biosimilar:

Afelimomab Biosimilar has been extensively studied and is currently approved for the treatment of various TNF-alpha related diseases, including rheumatoid arthritis, psoriasis, and Crohn’s disease. It is administered as an intravenous infusion and has shown to be highly effective in reducing the symptoms and progression of these diseases.

In rheumatoid arthritis, Afelimomab Biosimilar has been shown to improve joint pain, swelling, and stiffness, and also slow down the progression of joint damage. In psoriasis, it has been found to reduce the severity of skin lesions and improve quality of life. In Crohn’s disease, the antibody has been shown to induce and maintain remission in patients.

Moreover, Afelimomab Biosimilar has also shown promise in the treatment of other TNF-alpha related diseases, such as ankylosing spondylitis, ulcerative colitis, and psoriatic arthritis. Ongoing research is also exploring its potential in other autoimmune and inflammatory conditions.

Conclusion:

In conclusion, Afelimomab Biosimilar is a highly effective therapeutic option for patients suffering from TNF-alpha related diseases. Its unique structure and mechanism of action make it a potent inhibitor of TNF-alpha, providing relief from symptoms and slowing down disease progression. With ongoing research and development, this biosimilar has the potential to revolutionize the treatment of various inflammatory and autoimmune conditions.

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in ELISA Assay

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in ELISA Assay

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade

SDS-PAGE for Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in WB Assay

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in WB Assay

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

Afelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Afelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products