Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Adalimumab ELISA Kit

Recovery:
80-120%

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Adalimumab ELISA Kit

Adalimumab ELISA Kit

Product name Adalimumab ELISA Kit
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Delivery condition Blue ice (+4°C)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX127
Note For research use only.
Sample type Plasma, Serum
Target Adalimumab
Immunogen Adalimumab
Recovery 80-120%

Adalimumab ELISA Kit for Antibody Detection and Quantification

The Adalimumab ELISA kit is a highly sensitive immunoassay designed for the detection and quantification of Adalimumab, a monoclonal antibody targeting tumor necrosis factor alpha (TNF-α). This assay enables reliable measurement of Adalimumab concentrations in biological samples and supports research related to therapeutic antibody characterization, biosimilar development, and pharmacokinetic studies.

Adalimumab is widely studied in autoimmune and inflammatory disease research due to its role in blocking TNF-α signaling pathways. Accurate detection methods such as ELISA assays are essential for monitoring antibody levels and evaluating therapeutic antibody activity in experimental systems.

Research Applications

This Adalimumab ELISA kit is suitable for multiple research applications including:

  • quantification of Adalimumab in biological samples
  • biosimilar antibody development studies
  • pharmacokinetic and pharmacodynamic analysis
  • therapeutic antibody characterization
  • immunogenicity and antibody monitoring assays

The assay provides reliable sensitivity and reproducibility for laboratories working on anti-TNF monoclonal antibodies and related biologics.

Biological Background

Adalimumab is a fully human monoclonal antibody that binds tumor necrosis factor alpha (TNF-α), a cytokine involved in inflammatory signaling and immune regulation. Because TNF-α plays a key role in inflammatory diseases, antibodies targeting this pathway are extensively studied in therapeutic antibody research.

Sensitive immunoassays such as Adalimumab ELISA kits enable researchers to quantify antibody levels, evaluate antibody stability, and support analytical workflows related to antibody characterization and biosimilar comparison.

Adalimumab ELISA Kit Price

ProteoGenix offers competitive Adalimumab ELISA kit prices for research laboratories and biotech companies. Our assays combine high sensitivity and specificity while remaining cost-effective for antibody research and biosimilar development programs.

Related ELISA Kits

Related Services

Researchers working with therapeutic antibodies may also benefit from ProteoGenix services supporting antibody and biosimilar development:

These services support projects involving therapeutic antibodies, ELISA assay development, and biosimilar characterization.

Adalimumab ELISA Kit

There are no reviews yet.

Be the first to review “Adalimumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products