5′-nucleotidase(NT5E)

Reference:
Brand

Product type

Host Species

Size

,

Description of 5'-nucleotidase(NT5E)

Product name5'-nucleotidase(NT5E)
Uniprot IDP21589
Uniprot linkhttps://www.uniprot.org/uniprot/P21589
Origin speciesHomo sapiens (Human)
Expression systemProcaryotic expression
SequenceWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKG AEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEV VGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGG HSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLNSSI PEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNMGNLICDAMINNNLRHADETFWNHVSM CILNGGGIRSPIDERNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVV YDLSRKPGDRVVKLDVLCTKCRVPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVST YISKMKVIYPAVEGRIKFS
Molecular weight57.96 kDa
Protein delivered with Tag?N terminus His tag
Purity estimated>90% by SDS-PAGE
BufferPBS pH 7.5, 0.02% SKL
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeTrp27-Ser549
Protein AccessionP21589
Spec:Entrez GeneID4907
Spec:NCBI Gene AliasesNT; eN; NT5; NTE; eNT; CD73; E5NT; CALJA
Spec:SwissProtIDQ5W116
NCBI ReferenceP21589
Aliases /Synonyms5'-NT,5'-NT,CD_antigen: CD73,NT5, NTE
ReferencePX-P4803
NoteFor research use only

Reviews

There are no reviews yet.

Be the first to review “5′-nucleotidase(NT5E)”

Your email address will not be published. Required fields are marked *

Clear
OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us to order

+33 (0)3 90 20 54 70

Write us

Categories: