Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

116 kDa surface antigen

Host species:
Escherichia coli (E.coli)
Uniprot ID:
O07713
Molecular weight:
53.30KDa

Original price was: €271.00.Current price is: €210.00.

50ug 23% OFF + 210 loyalty points
Leu12–Glu477
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

116 kDa surface antigen

Product name 116 kDa surface antigen
Uniprot ID O07713
Uniprot link https://www.uniprot.org/uniprot/O07713
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLSVAGTVGTTAVVVPTTITLVNKTHQVEHESEQSDFQDIRFGLNSVKLPKAQPAAATRITVENGTDKLVNYKSSPQQLFLAKNALKDKLQGEFDKFLSDAKAFPALTADLQEWVDQQLFNPNQSFFDLSAPRSNFTLSSDKKASLDFIFRFTNFTESVQLLKLPEGVSVVVDSKQSFDYYVNASAQKLLVLPLSLPDYTLGLNYMFDHITLNGKVVNKFSFNPFKTNLNLAFSNVYNGVDVFEAQKNLVGKGKYLNTHVKAEDVKKDVNANIKNQFDIAKIIAELMGKALKEFGNQQEGQPLSFLKVMDKVKEDFEKLFNLVRPGLGKFVKGLIQSSSQAENKITVYKLIFDNKKTILNLLKELSIPELNSSLGLVDVLFDVITDSDGLYERLQSFKDLIVPAVKTNEKTAALSPLIEELLTQKDTYVFDLIQKHKGILTNLLKNFLADFQKSTPFMADQVAIFTE
Molecular weight 53.30KDa
Purity estimated 50%
Buffer 20 mM Tris-HCl pH 8.0, 100 mM NaCl, 1 mM DTT, 0.1% sodium azide, 0.1mM EDTA, 10% glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu12-Glu477
Aliases /Synonyms 116 kDa surface antigen
Reference PX-P4360
Note For research use only
Molecular Constructor
Leu12–Glu477
Product name 116 kDa surface antigen
Uniprot ID O07713
Uniprot link https://www.uniprot.org/uniprot/O07713
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLSVAGTVGTTAVVVPTTITLVNKTHQVEHESEQSDFQDIRFGLNSVKLPKAQPAAATRITVENGTDKLVNYKSSPQQLFLAKNALKDKLQGEFDKFLSDAKAFPALTADLQEWVDQQLFNPNQSFFDLSAPRSNFTLSSDKKASLDFIFRFTNFTESVQLLKLPEGVSVVVDSKQSFDYYVNASAQKLLVLPLSLPDYTLGLNYMFDHITLNGKVVNKFSFNPFKTNLNLAFSNVYNGVDVFEAQKNLVGKGKYLNTHVKAEDVKKDVNANIKNQFDIAKIIAELMGKALKEFGNQQEGQPLSFLKVMDKVKEDFEKLFNLVRPGLGKFVKGLIQSSSQAENKITVYKLIFDNKKTILNLLKELSIPELNSSLGLVDVLFDVITDSDGLYERLQSFKDLIVPAVKTNEKTAALSPLIEELLTQKDTYVFDLIQKHKGILTNLLKNFLADFQKSTPFMADQVAIFTE
Molecular weight 53.30KDa
Purity estimated 50%
Buffer 20 mM Tris-HCl pH 8.0, 100 mM NaCl, 1 mM DTT, 0.1% sodium azide, 0.1mM EDTA, 10% glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu12-Glu477
Aliases /Synonyms 116 kDa surface antigen
Reference PX-P4360
Note For research use only
Molecular Constructor
Leu12–Glu477
Product name PX-P4360-1MG
Uniprot ID O07713
Uniprot link https://www.uniprot.org/uniprot/O07713
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLSVAGTVGTTAVVVPTTITLVNKTHQVEHESEQSDFQDIRFGLNSVKLPKAQPAAATRITVENGTDKLVNYKSSPQQLFLAKNALKDKLQGEFDKFLSDAKAFPALTADLQEWVDQQLFNPNQSFFDLSAPRSNFTLSSDKKASLDFIFRFTNFTESVQLLKLPEGVSVVVDSKQSFDYYVNASAQKLLVLPLSLPDYTLGLNYMFDHITLNGKVVNKFSFNPFKTNLNLAFSNVYNGVDVFEAQKNLVGKGKYLNTHVKAEDVKKDVNANIKNQFDIAKIIAELMGKALKEFGNQQEGQPLSFLKVMDKVKEDFEKLFNLVRPGLGKFVKGLIQSSSQAENKITVYKLIFDNKKTILNLLKELSIPELNSSLGLVDVLFDVITDSDGLYERLQSFKDLIVPAVKTNEKTAALSPLIEELLTQKDTYVFDLIQKHKGILTNLLKNFLADFQKSTPFMADQVAIFTE
Molecular weight 53.30KDa
Purity estimated 50%
Buffer 20 mM Tris-HCl pH 8.0, 100 mM NaCl, 1 mM DTT, 0.1% sodium azide, 0.1mM EDTA, 10% glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu12-Glu477
Aliases /Synonyms 116 kDa surface antigen
Reference PX-P4360
Note For research use only
Molecular Constructor
Leu12–Glu477

116 kDa surface antigen

There are no reviews yet.

Be the first to review “116 kDa surface antigen”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products