Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RXFP1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9HBX9
Molecular weight:
19.67 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
His260–Arg409
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RXFP1, N-His

Product name ARO-P13096-100
Uniprot ID Q9HBX9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDELDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQR
Molecular weight 19.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His260-Arg409
Aliases /Synonyms LGR7, Relaxin family peptide receptor 1, Relaxin receptor 1, Leucine-rich repeat-containing G-protein coupled receptor 7, RXFP1
Reference ARO-P13096
Note For research use only.
Molecular Constructor
His260–Arg409
Product name ARO-P13096-1MG
Uniprot ID Q9HBX9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDELDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQR
Molecular weight 19.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His260-Arg409
Aliases /Synonyms LGR7, Relaxin family peptide receptor 1, Relaxin receptor 1, Leucine-rich repeat-containing G-protein coupled receptor 7, RXFP1
Reference ARO-P13096
Note For research use only.
Molecular Constructor
His260–Arg409
Product name ARO-P13096-50
Uniprot ID Q9HBX9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDELDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQR
Molecular weight 19.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His260-Arg409
Aliases /Synonyms LGR7, Relaxin family peptide receptor 1, Relaxin receptor 1, Leucine-rich repeat-containing G-protein coupled receptor 7, RXFP1
Reference ARO-P13096
Note For research use only.
Molecular Constructor
His260–Arg409

Introduction to Recombinant Human RXFP1

Recombinant Human RXFP1 is a protein that plays a crucial role in various biological processes, including reproduction, cardiovascular function, and metabolism. This protein is a member of the G protein-coupled receptor (GPCR) family and is encoded by the RXFP1 gene. It is found in various tissues and cells, such as the reproductive organs, heart, and adipose tissue. In this article, we will discuss the structure, activity, and applications of Recombinant Human RXFP1.

Structure of Recombinant Human RXFP1

Recombinant Human RXFP1 is a transmembrane protein that consists of 747 amino acids. It has a large extracellular domain, seven transmembrane helices, and an intracellular C-terminal tail. The extracellular domain contains a leucine-rich repeat (LRR) region, which is responsible for ligand binding. The transmembrane helices are involved in signal transduction, while the C-terminal tail interacts with intracellular signaling molecules.

The most notable feature of Recombinant Human RXFP1 is its ability to bind to relaxin hormones. These hormones are small peptides that play a crucial role in reproductive processes, such as ovulation, implantation, and labor. The LRR region of Recombinant Human RXFP1 is responsible for binding to relaxin hormones, specifically the H2 relaxin isoform.

Activity of Recombinant Human RXFP1

Recombinant Human RXFP1 is a GPCR, which means it is involved in signal transduction. When a ligand, such as H2 relaxin, binds to the extracellular domain of Recombinant Human RXFP1, it triggers a series of events that ultimately lead to a cellular response. This response can vary depending on the tissue or cell type in which Recombinant Human RXFP1 is expressed.

One of the main activities of Recombinant Human RXFP1 is its role in reproductive processes. As mentioned earlier, it is involved in ovulation, implantation, and labor. In ovulation, Recombinant Human RXFP1 is expressed in the ovaries and binds to H2 relaxin, which helps in the release of the egg from the ovary. In implantation, Recombinant Human RXFP1 is expressed in the uterus and helps in the attachment of the embryo to the uterine wall. In labor, Recombinant Human RXFP1 is involved in the softening of the cervix and the contraction of the uterus, both of which are essential for childbirth.

Apart from reproductive processes, Recombinant Human RXFP1 also plays a role in cardiovascular function. It is expressed in the heart and is involved in regulating heart rate and blood pressure. Additionally, Recombinant Human RXFP1 is found in adipose tissue and is involved in regulating metabolism and fat storage.

Applications of Recombinant Human RXFP1

Recombinant Human RXFP1 has several potential applications in the field of medicine. One of the most promising applications is in the treatment of reproductive disorders. As Recombinant Human RXFP1 is involved in ovulation and implantation, it can be used to treat infertility in women. It can also be used to induce labor in pregnant women who are overdue.

Another potential application is in the treatment of cardiovascular diseases. As Recombinant Human RXFP1 is involved in regulating heart rate and blood pressure, it can be used to treat conditions such as hypertension and heart failure.

Furthermore, Recombinant Human RXFP1 can also be used as a diagnostic tool. As it is found in various tissues and cells, its expression levels can be measured to assess the health of these tissues and cells. For example, abnormal levels of Recombinant Human RXFP1 in the heart can indicate the presence of cardiovascular disease.

Recombinant Human RXFP1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RXFP1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products