Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zolimomab Biosimilar – Anti-CD5 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade

Product name Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade
Uniprot ID P06127
Source CAS 141483-72-9
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Zolimomab,H65-ricin A chain immunotoxin,H65-RTA,CD5,anti-CD5
Reference PX-TA1226
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade
Uniprot ID P06127
Source CAS 141483-72-9
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Zolimomab,H65-ricin A chain immunotoxin,H65-RTA,CD5,anti-CD5
Reference PX-TA1226
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1226-50
Uniprot ID P06127
Source CAS 141483-72-9
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Zolimomab,H65-ricin A chain immunotoxin,H65-RTA,CD5,anti-CD5
Reference PX-TA1226
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Zolimomab Biosimilar – Anti-CD5 mAb – Research Grade: A Promising Antibody for Therapeutic Targeting

Introduction

Zolimomab Biosimilar, also known as Anti-CD5 monoclonal antibody (mAb), is a novel therapeutic agent that has gained significant attention in the field of immunotherapy. This biosimilar version of Zolimomab is a highly specific antibody that targets the CD5 antigen, a cell surface protein found on T cells and B cells. In this article, we will explore the structure, activity, and potential applications of Zolimomab Biosimilar as a promising antibody for therapeutic targeting.

Structure of Zolimomab Biosimilar

Zolimomab Biosimilar is a recombinant humanized IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the CD5 antigen, while the constant region mediates effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Zolimomab Biosimilar

Zolimomab Biosimilar exerts its activity by binding to the CD5 antigen, which is overexpressed on the surface of T cells and B cells in various hematological malignancies. This binding leads to the activation of signaling pathways that induce cell death and inhibit cell proliferation. Moreover, Zolimomab Biosimilar can also recruit immune effector cells, such as natural killer (NK) cells, to induce ADCC and CDC against CD5-positive cells.

Potential Applications of Zolimomab Biosimilar

Zolimomab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various hematological malignancies, including T-cell acute lymphoblastic leukemia, chronic lymphocytic leukemia, and non-Hodgkin’s lymphoma. In addition, it has also shown potential in the treatment of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, where CD5-positive T cells play a crucial role in disease pathogenesis.

Advantages of Zolimomab Biosimilar

Compared to the original Zolimomab, the biosimilar version offers several advantages. First, it is more cost-effective, making it more accessible to patients. Second, it has a lower potential for immunogenicity, as it is produced using advanced recombinant DNA technology. Third, it has a longer half-life, which allows for less frequent dosing and improved patient compliance.

Conclusion

In conclusion, Zolimomab Biosimilar is a promising antibody for therapeutic targeting due to its highly specific binding to the CD5 antigen and its potential to induce cell death and immune-mediated cytotoxicity. Its structure, activity, and potential applications make it a valuable addition to the arsenal of immunotherapeutic agents. With ongoing research and development, Zolimomab Biosimilar holds great promise for the treatment of various hematological malignancies and autoimmune diseases.

SDS-PAGE for Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade

SDS-PAGE for Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade

Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Zolimomab Biosimilar – Anti-CD5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products