Brand: ProteoGenix

Zinc transporter 8(SLC30A8)

PX-P4648-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q8IWU4

€210.00

50ug + 210 loyalty points

Met275–Asp369 + PSTPPGSSGGG + Leu267-Asp369 10*His

size size

50ug €210.00
100ug €394.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

MSDS

Zinc transporter 8(SLC30A8)

Product name	Zinc transporter 8(SLC30A8)
Uniprot ID	Q8IWU4
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MEFMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCDPSTPPGSSGGGLKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASWDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCDHHHHHHHHHH
Protein delivered with Tag?	C-terminal 10*His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Yeast
Fragment Type	Met275-Asp369 + PSTPPGSSGGG + Leu267-Asp369
Aliases /Synonyms	ZnT-8, Solute carrier family 30 member 8,ZNT8
Reference	PX-P4648
Note	For research use only
Molecular Constructor	Met275–Asp369 + PSTPPGSSGGG + Leu267-Asp369 10*His

Product name	Zinc transporter 8(SLC30A8)
Uniprot ID	Q8IWU4
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MEFMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCDPSTPPGSSGGGLKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASWDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCDHHHHHHHHHH
Protein delivered with Tag?	C-terminal 10*His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Yeast
Fragment Type	Met275-Asp369 + PSTPPGSSGGG + Leu267-Asp369
Aliases /Synonyms	ZnT-8, Solute carrier family 30 member 8,ZNT8
Reference	PX-P4648
Note	For research use only
Molecular Constructor	Met275–Asp369 + PSTPPGSSGGG + Leu267-Asp369 10*His