Name: Human BNP peptide-Natriuretic peptides B
SKU: PX-P4047-10
Availability: InStock

Product name	Human BNP peptide-Natriuretic peptides B
Uniprot ID	P16860
Uniprot link	http://www.uniprot.org/uniprot/P16860
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR
Molecular weight	28.85kDa
Protein delivered with Tag?	Yes
Purity estimated	85%
Buffer	50 mM Tris-HCl pH 8, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
Aliases /Synonyms	NT-PROBNP, BNP, Natriuretic peptide B, GC-B, B-Type Natriuretic Peptide, Ventricular Natriuretic Peptide, Gamma-brain natriuretic peptide, Brain natriuretic peptide 32
Reference	PX-P4047
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human BNP peptide-Natriuretic peptides B”

size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.