Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P29459&P29460
Molecular weight:
40kDa & 43kDa

€210.00

50ug + 210 loyalty points
Met1–Ser219 Il12A & Il12B( Met1-Ser328 Strep His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)

Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)

Product name Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)
Uniprot ID P29459&P29460
Uniprot link https://www.uniprot.org/uniprot/P29459 & https://www.uniprot.org/uniprot/P29460
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 40kDa & 43kDa
Protein delivered with Tag? C-terminal Strep tag & C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Il12A(Met1-Ser219) & Il12B( Met1-Ser328)
Protein Accession P29459&P29460
Spec:Entrez GeneID 3592 & 3593
Spec:NCBI Gene Aliases P35; CLMF; NFSK; NKSF1; IL-12A; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B
Spec:SwissProtID Q96QZ1
NCBI Reference P29459&P29460
Aliases /Synonyms IL12AB
Reference PX-P4576
Note For research use only
Molecular Constructor
Met1–Ser219 Il12A & Il12B( Met1-Ser328 Strep His
Product name Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)
Uniprot ID P29459&P29460
Uniprot link https://www.uniprot.org/uniprot/P29459 & https://www.uniprot.org/uniprot/P29460
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 40kDa & 43kDa
Protein delivered with Tag? C-terminal Strep tag & C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Il12A(Met1-Ser219) & Il12B( Met1-Ser328)
Protein Accession P29459&P29460
Spec:Entrez GeneID 3592 & 3593
Spec:NCBI Gene Aliases P35; CLMF; NFSK; NKSF1; IL-12A; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B
Spec:SwissProtID Q96QZ1
NCBI Reference P29459&P29460
Aliases /Synonyms IL12AB
Reference PX-P4576
Note For research use only
Molecular Constructor
Met1–Ser219 Il12A & Il12B( Met1-Ser328 Strep His

There are no reviews yet.

Be the first to review “Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products