Cart (0 Items)
Your cart is currently empty.
View Products
              
              
              | size | 100ug, 50ug  | 
		
|---|---|
| Brand | ProteoGenix  | 
		
| Product type | Recombinant Proteins  | 
		
| Host Species | Escherichia coli (E. coli)  | 
		
| Applications | Elisa, WB  | 
		
| Product name | Tyrosine-protein phosphatase YopH (yopH) | 
|---|---|
| Uniprot ID | P15273 | 
| Uniprot link | https://www.uniprot.org/uniprot/P15273 | 
| Expression system | Prokaryotic expression | 
| Sequence | MGSHHHHHHSGMNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVLSHVANIVLT QEDTAKLLQSTVKHNLNNYELRSVGNGNSVLVSLRSDQMTLQDAKVLLEAALRQESGARGHVSSHSHSVLHAPGTPVREG LRSHLDPRTPPLPPRERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACGGEKLNRF RDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPVLAVLASSSEIANQRFGMPDYFRQSGTYG SITVESKMTQQVGLGDGIMADMYTLTIREAGQKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGS | 
| Molecular weight | 52.10kDa | 
| Purity estimated | 95% by SDS-PAGE | 
| Buffer | 20 mM Tris-HCl pH8.0, 100 mM NaCl,1 mM DTT,0,1% sodium azide,0.1mM EDTA, 10% glycerol | 
| Delivery condition | Dry Ice | 
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days  | 
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) | 
| Brand | ProteoGenix | 
| Host species | Escherichia coli (E.coli) | 
| Fragment Type | Met12-Ser399 | 
| Aliases /Synonyms | Tyrosine-protein phosphatase YopH, Virulence protein | 
| Reference | PX-P4379 | 
| Note | For research use only | 
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.