Trypanosoma PLB Recombinant Protein N-Ter His tag

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameTrypanosoma PLB Recombinant Protein N-Ter His tag
Uniprot IDF9WF01
Uniprot linkhttp://www.uniprot.org/uniprot/F9WF01
Origin speciesTrypanosoma
Expression systemProcaryotic expression
SequenceMAHNHRHKHKLMLKNMTRDTFWVVEQLPGKAAPLGITAKDMTSVLNTSGYWASYNRPYFPNVYNLSGIHDMWKKYGDFYS YKNYSRARIFARDEGKVEDLASMKRLMRYNNYTKDPFSLIPNCSRTNSSFDDEETAPSVCKPPYSAMLSIAARGDLNPTG NDTFYGPLYRSVGHVDSAATDAKIATWSGMMKGNGTYTAHVICGPTTDGLPPFSWKNDIFDPMPPTFGLPKVYNFSFVVM TTVLPSPSKGSLWSRTGIIAIVAALVVGTIAVVLMRPRKDSEEDDALPEETEGLVDPIE
Molecular weight33.31 kDa
Protein delivered with Tag?Yes
Purity estimated80%
BufferPBS, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionCCD15867.1
Spec:SwissProtIDF9WF01
NCBI ReferenceCCD15867.1
Aliases /SynonymsPLB, unnamed protein product
ReferencePX-P1141
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Trypanosoma PLB Recombinant Protein N-Ter His tag”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.