Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Trypanosoma PLB Recombinant Protein C-Ter His tag

Host species:
Escherichia coli (E.coli)
Origin species:
Trypanosoma
Uniprot ID:
F9WF01
Molecular weight:
33,48 kDa

210.00

50ug + 210 loyalty points
Full-length Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Trypanosoma PLB Recombinant Protein C-Ter His tag

Product name Trypanosoma PLB Recombinant Protein C-Ter His tag
Uniprot ID F9WF01
Uniprot link http://www.uniprot.org/uniprot/F9WF01
Origin species Trypanosoma
Expression system Prokaryotic expression
Raw Antigen Sequence MLKNMTRDTFWVVEQLPGKAAPLGITAKDMTSVLNTSGYWASYNRPYFPNVYNLSGIHDMWKKYGDFYSYKNYSRARIFARDEGKVEDLASMKRLMRYNNYTKDPFSLIPNCSRTNSSFDDEETAPSVCKPPYSAMLSIAARGDLNPTGNDTFYGPLYRSVGHVDSAATDAKIATWSGMMKGNGTYTAHVICGPTTDGLPPFSWKNDIFDPMPPTFGLPKVYNFSFVVMTTVLPSPSKGSLWSRTGIIAIVAALVVGTIAVVLMRPRKDSEEDDALPEETEGLVDPIE
Molecular weight 33,48 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession CCD15867.1
Spec:SwissProtID F9WF01
NCBI Reference CCD15867.1
Aliases /Synonyms PLB, unnamed protein product
Reference PX-P1142
Note For research use only
Molecular Constructor
Full-length Yes
Product name Trypanosoma PLB Recombinant Protein C-Ter His tag
Uniprot ID F9WF01
Uniprot link http://www.uniprot.org/uniprot/F9WF01
Origin species Trypanosoma
Expression system Prokaryotic expression
Raw Antigen Sequence MLKNMTRDTFWVVEQLPGKAAPLGITAKDMTSVLNTSGYWASYNRPYFPNVYNLSGIHDMWKKYGDFYSYKNYSRARIFARDEGKVEDLASMKRLMRYNNYTKDPFSLIPNCSRTNSSFDDEETAPSVCKPPYSAMLSIAARGDLNPTGNDTFYGPLYRSVGHVDSAATDAKIATWSGMMKGNGTYTAHVICGPTTDGLPPFSWKNDIFDPMPPTFGLPKVYNFSFVVMTTVLPSPSKGSLWSRTGIIAIVAALVVGTIAVVLMRPRKDSEEDDALPEETEGLVDPIE
Molecular weight 33.48 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession CCD15867.1
Spec:SwissProtID F9WF01
NCBI Reference CCD15867.1
Aliases /Synonyms PLB, unnamed protein product
Reference PX-P1142
Note For research use only
Molecular Constructor
Full-length Yes

Trypanosoma PLB Recombinant Protein C-Ter His tag

There are no reviews yet.

Be the first to review “Trypanosoma PLB Recombinant Protein C-Ter His tag”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products