Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tocilizumab Biosimilar – Anti-IL-6R mAb – Research Grade

  • PX-TA1030-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €272.00.Current price is: €200.00.

100ug 26% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tocilizumab Biosimilar - Anti-IL-6R mAb - Research Grade

Product name Tocilizumab Biosimilar - Anti-IL-6R mAb - Research Grade
Uniprot ID P08887
Source IMGT8394
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Molecular weight 150kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tocilizumab,IL-6R,anti-IL-6R, Atlizumab
Reference PX-TA1030
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody
Product name Tocilizumab Biosimilar - Anti-IL-6R mAb - Research Grade
Uniprot ID P08887
Source IMGT8394
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Molecular weight 150kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tocilizumab,IL-6R,anti-IL-6R, Atlizumab
Reference PX-TA1030
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody
Product name PX-TA1030-50
Uniprot ID P08887
Source IMGT8394
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Molecular weight 150kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Tocilizumab,IL-6R,anti-IL-6R, Atlizumab
Reference PX-TA1030
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Tocilizumab Therapeutic Antibody

The tocilizumab antibody is an IgG1 kappa monoclonal protein obtained from mouse hybridoma and subsequently humanized for use in antibody therapy. Tocilizumab acts as an immunosuppressant and it has been designed to bind the human interleukin 6 receptor (IL-6R), which occurs in membrane-bound or soluble form. The receptor is known to bind IL-6, a 21-26 kDa glycoprotein, and mediate proinflammatory reactions in response to infections or tissue injuries.

IL-6 production is triggered locally and only during the early stages of inflammation. Despite its key role in the immune response, IL-6 overproduction has been observed in different chronic inflammatory diseases and some forms of cancer. Moreover, its presence has been linked with the excessive and potentially fatal inflammatory responses known as “cytokine storm.”

Tocilizumab is one of the first humanized monoclonal antibodies ever to be licensed and commercialized as an efficient IL6R blocker. Due to its specificity, it is recurrently used to treat autoimmune conditions such as rheumatoid arthritis, cytokine release syndrome (or “cytokine storm”), and polyarticular juvenile idiopathic arthritis; some forms of cancer such as Castleman’s disease; and inflammatory diseases such as giant cell arteritis.

Recent studies showed that IL-6 levels in COVID-19 patients on ventilators can be 10 times higher in comparison to patients with milder symptoms of the disease. Exacerbated levels of the proinflammatory molecule have previously been observed in other coronavirus-mediated diseases such as the Severe Acute Respiratory Syndrome (SARS) and Middle East Respiratory Syndrome (MERS). In these diseases as in the case of COVID-19, the leading cause of death appears to be severe lung inflammation in the form of “cytokine storm.”

The efficiency of Tocilizumab in the COVID-19 disease has been recently reported in several observational studies, including a study from Italy where researchers reported improved oxygenation in 74% and 65% of the patients on mechanical or non-invasive ventilation, respectively. Multiple randomized, double-blind, and placebo-controlled clinical trials are currently underway to validate the efficiency of this IgG1 antibody for the treatment of the COVID-19 disease. This product is for research use only.

SDS-PAGE for Tocilizumab Biosimilar - Anti-IL-6R mAb

SDS-PAGE for Tocilizumab Biosimilar - Anti-IL-6R mAb

Tocilizumab Biosimilar - Anti-IL-6R mAb, on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tocilizumab Biosimilar - Anti-IL-6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Tocilizumab Biosimilar - Anti-IL-6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Immobilized CD126 Recombinant Protein (cat. No.PX-P4104) at 0.5µg/mL (100µL/well) can bind to Tocilizumab Biosimilar - Anti-IL-6R mAb (cat. No.PX-TA1030) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Tocilizumab Biosimilar - Anti-IL-6R mAb - Research Grade

There are no reviews yet.

Be the first to review “Tocilizumab Biosimilar – Anti-IL-6R mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products