Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Thy-1 membrane glycoprotein(THY1)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P04216
Molecular weight:
22-30kDa(14.55 kDa)

210.00

50ug + 210 loyalty points
Met1–Cys130 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Thy-1 membrane glycoprotein(THY1)

Product name Thy-1 membrane glycoprotein(THY1)
Uniprot ID P04216
Uniprot link https://www.uniprot.org/uniprot/P04216
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Molecular weight 22-30kDa(14.55 kDa)
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Cys130
Protein Accession P04216
Spec:Entrez GeneID 7070
Spec:NCBI Gene Aliases CD90; CDw90
Spec:SwissProtID Q9NSP1
NCBI Reference P04216
Aliases /Synonyms CDw90,Thy-1 antigen, CD90
Reference PX-P4582
Note For research use only
Molecular Constructor
Met1–Cys130 His
Product name Thy-1 membrane glycoprotein(THY1)
Uniprot ID P04216
Uniprot link https://www.uniprot.org/uniprot/P04216
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Molecular weight 22-30kDa(14.55 kDa)
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Cys130
Protein Accession P04216
Spec:Entrez GeneID 7070
Spec:NCBI Gene Aliases CD90; CDw90
Spec:SwissProtID Q9NSP1
NCBI Reference P04216
Aliases /Synonyms CDw90,Thy-1 antigen, CD90
Reference PX-P4582
Note For research use only
Molecular Constructor
Met1–Cys130 His

There are no reviews yet.

Be the first to review “Thy-1 membrane glycoprotein(THY1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products