Terminal nucleotidyltransferase 4A(Tent4a)Mouse

Reference:
Product nameTerminal nucleotidyltransferase 4A(Tent4a)Mouse
Uniprot IDQ6PB75
Uniprot linkhttps://www.uniprot.org/uniprot/Q6PB75
Expression systemProcaryotic expression
SequenceMGSHHHHHHSGSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRK HNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGG ISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCI EDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDSESTLGRIIKVTQEVIDYRRWIKEKWGSRILPSP DLDNRIKIKERITTCNGEQMQSREPSSPYTQRLTLSLSSPQLLSSGSSASSVSSLSGSDIDSDTPPCTTPSVYQFSLQAP TTLMASLPTALPMPSSKPQPAASRTLIMTTNNQTRVTIPPPTLGVAPVPCRQAGVDGTTSLKAVHSVTSPAIPSASPNPL SSPHLYHKQHNGMKLSMKGSHNHTQGGGYSSVGSGAVRPPVGNRGHHQYNRTGWRRKKHAHTRDSLPVSLSR
Molecular weight61.1kDa
Protein delivered with Tag?N-terminal His Tag
Purity estimated>65% by SDS-PAGE
BufferPBS, pH7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeSer2-Arg542
Protein AccessionQ6PB75
Spec:Entrez GeneID210106
Spec:NCBI Gene AliasesPa; LAK; TRF; POLK; Pols; TRF4; LAK-1; Papd7; TRF4-; TRF4-1
Spec:SwissProtIDG3X948
NCBI ReferenceQ6PB75
Aliases /SynonymsDNA polymerase sigma,Non-canonical poly(A) RNA polymerase PAPD7,PAP-associated domain-containing protein 7,TRAMP-like complex polyadenylate polymerase,Terminal guanylyltransferase,Papd7
ReferencePX-P4815
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Terminal nucleotidyltransferase 4A(Tent4a)Mouse”

Your email address will not be published. Required fields are marked *

Related products

Anti His tag mouse monoclonal antibody
Tag Antibody Anti His tag mouse monoclonal antibody PTX17851-100 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.