Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Terminal nucleotidyltransferase 4A(Tent4a)Mouse

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q6PB75
Molecular weight:
61.1kDa

210.00

50ug + 210 loyalty points
His Ser2–Arg542
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Terminal nucleotidyltransferase 4A(Tent4a)Mouse

Product name Terminal nucleotidyltransferase 4A(Tent4a)Mouse
Uniprot ID Q6PB75
Uniprot link https://www.uniprot.org/uniprot/Q6PB75
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRK HNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGG ISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCI EDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDSESTLGRIIKVTQEVIDYRRWIKEKWGSRILPSP DLDNRIKIKERITTCNGEQMQSREPSSPYTQRLTLSLSSPQLLSSGSSASSVSSLSGSDIDSDTPPCTTPSVYQFSLQAP TTLMASLPTALPMPSSKPQPAASRTLIMTTNNQTRVTIPPPTLGVAPVPCRQAGVDGTTSLKAVHSVTSPAIPSASPNPL SSPHLYHKQHNGMKLSMKGSHNHTQGGGYSSVGSGAVRPPVGNRGHHQYNRTGWRRKKHAHTRDSLPVSLSR
Molecular weight 61.1kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >65% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Arg542
Protein Accession Q6PB75
Spec:Entrez GeneID 210106
Spec:NCBI Gene Aliases Pa; LAK; TRF; POLK; Pols; TRF4; LAK-1; Papd7; TRF4-; TRF4-1
Spec:SwissProtID G3X948
NCBI Reference Q6PB75
Aliases /Synonyms DNA polymerase sigma,Non-canonical poly(A) RNA polymerase PAPD7,PAP-associated domain-containing protein 7,TRAMP-like complex polyadenylate polymerase,Terminal guanylyltransferase,Papd7
Reference PX-P4815
Note For research use only
Molecular Constructor
His Ser2–Arg542
Product name Terminal nucleotidyltransferase 4A(Tent4a)Mouse
Uniprot ID Q6PB75
Uniprot link https://www.uniprot.org/uniprot/Q6PB75
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRK HNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGG ISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCI EDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDSESTLGRIIKVTQEVIDYRRWIKEKWGSRILPSP DLDNRIKIKERITTCNGEQMQSREPSSPYTQRLTLSLSSPQLLSSGSSASSVSSLSGSDIDSDTPPCTTPSVYQFSLQAP TTLMASLPTALPMPSSKPQPAASRTLIMTTNNQTRVTIPPPTLGVAPVPCRQAGVDGTTSLKAVHSVTSPAIPSASPNPL SSPHLYHKQHNGMKLSMKGSHNHTQGGGYSSVGSGAVRPPVGNRGHHQYNRTGWRRKKHAHTRDSLPVSLSR
Molecular weight 61.1kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >65% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Arg542
Protein Accession Q6PB75
Spec:Entrez GeneID 210106
Spec:NCBI Gene Aliases Pa; LAK; TRF; POLK; Pols; TRF4; LAK-1; Papd7; TRF4-; TRF4-1
Spec:SwissProtID G3X948
NCBI Reference Q6PB75
Aliases /Synonyms DNA polymerase sigma,Non-canonical poly(A) RNA polymerase PAPD7,PAP-associated domain-containing protein 7,TRAMP-like complex polyadenylate polymerase,Terminal guanylyltransferase,Papd7
Reference PX-P4815
Note For research use only
Molecular Constructor
His Ser2–Arg542

There are no reviews yet.

Be the first to review “Terminal nucleotidyltransferase 4A(Tent4a)Mouse”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products