Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tecaginlimab Biosimilar – Anti-CD40 & CD137 mAb – Research Grade

  • PX-TA1777-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tecaginlimab Biosimilar - Anti-CD40 & CD137 mAb - Research Grade

Product name Tecaginlimab Biosimilar - Anti-CD40 & CD137 mAb - Research Grade
Uniprot ID P25942 & Q07011
Source CAS: 2253891-70-0
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tecaginlimab,BNT-312, DuoBody-CD40x-4-1BB, GEN 1042, GEN-1042, GEN1042,CD40 & CD137,anti-CD40 & CD137
Reference PX-TA1777
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tecaginlimab Biosimilar - Anti-CD40 & CD137 mAb - Research Grade
Uniprot ID P25942 & Q07011
Source CAS: 2253891-70-0
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tecaginlimab,BNT-312, DuoBody-CD40x-4-1BB, GEN 1042, GEN-1042, GEN1042,CD40 & CD137,anti-CD40 & CD137
Reference PX-TA1777
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1777-50
Uniprot ID P25942 & Q07011
Source CAS: 2253891-70-0
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tecaginlimab,BNT-312, DuoBody-CD40x-4-1BB, GEN 1042, GEN-1042, GEN1042,CD40 & CD137,anti-CD40 & CD137
Reference PX-TA1777
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Tecaginlimab Biosimilar, also known as Anti-CD40 & CD137 mAb, is a research grade antibody that has shown promising results in preclinical studies as a potential therapeutic agent. It is a biosimilar of the monoclonal antibody (mAb) tecaginlimab, which targets both CD40 and CD137, two important immune checkpoints that play a crucial role in regulating the immune response. In this article, we will discuss the structure, activity, and potential applications of Tecaginlimab Biosimilar.

Structure of Tecaginlimab Biosimilar

Tecaginlimab Biosimilar is a recombinant humanized monoclonal antibody, meaning that it is produced in a laboratory using genetic engineering techniques. It is composed of two heavy chains and two light chains, linked together by disulfide bonds. The heavy chains are made up of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains consist of one constant region (CL) and one variable region (VL). The variable regions are responsible for binding to the target molecules, CD40 and CD137.

Activity of Tecaginlimab Biosimilar

CD40 and CD137 are both co-stimulatory molecules that are expressed on the surface of various immune cells, including T cells, B cells, and dendritic cells. These molecules play a critical role in activating and regulating the immune response. CD40 is involved in T cell activation, B cell differentiation, and cytokine production, while CD137 is involved in T cell proliferation and survival. Dysregulation of these pathways has been implicated in various autoimmune diseases and cancer.

Tecaginlimab Biosimilar works by binding to both CD40 and CD137, blocking their interaction with their respective ligands and inhibiting their signaling pathways. This leads to a reduction in the activation and proliferation of immune cells, resulting in a dampened immune response. In addition, Tecaginlimab Biosimilar has been shown to induce antibody-dependent cell-mediated cytotoxicity (ADCC), where immune cells are activated to kill target cells that are bound by the antibody.

Applications of Tecaginlimab Biosimilar

The potential applications of Tecaginlimab Biosimilar are vast, given its ability to target two important immune checkpoints simultaneously. It has shown promising results in preclinical studies as a potential treatment for various autoimmune diseases, including rheumatoid arthritis, multiple sclerosis, and psoriasis. By inhibiting the activation of immune cells, Tecaginlimab Biosimilar could potentially reduce the severity of these diseases and improve patient outcomes.

In addition, Tecaginlimab Biosimilar has also shown potential as a cancer therapy. CD40 and CD137 have been identified as potential targets for cancer immunotherapy, and blocking their activity with Tecaginlimab Biosimilar could enhance the anti-tumor immune response. Preclinical studies have shown that Tecaginlimab Biosimilar can inhibit tumor growth and improve survival rates in animal models of cancer.

Conclusion

Tecaginlimab Biosimilar, a research grade antibody targeting both CD40 and CD137, has shown great potential as a therapeutic agent in preclinical studies. Its unique structure and mechanism of action make it a promising candidate for the treatment of various autoimmune diseases and cancer. Further research and clinical trials are needed to fully understand the potential of Tecaginlimab Biosimilar and its role in improving patient outcomes.

SDS-PAGE for Tecaginlimab Biosimilar - Anti-CD40 &, CD137 mAb - Research Grade

SDS-PAGE for Tecaginlimab Biosimilar - Anti-CD40 &amp, CD137 mAb - Research Grade

Tecaginlimab Biosimilar - Anti-CD40 &, CD137 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flow Cytometry results for Tecaginlimab Biosimilar - Anti-CD40 &, CD137 mAb - Research Grade

Flow Cytometry results for Tecaginlimab Biosimilar - Anti-CD40 &amp, CD137 mAb - Research Grade

Flow-cytometry using PE anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human CD40 monoclonal antibody (Catalog: PX-TA1777, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Tecaginlimab Biosimilar - Anti-CD40 & CD137 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tecaginlimab Biosimilar – Anti-CD40 & CD137 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products