Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tanezumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Tanezumab ELISA Kit

Tanezumab ELISA Kit

Product name Tanezumab ELISA Kit
Uniprot ID P01138
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX126
Note For research use only.
Sample type Plasma, Serum
Target Tanezumab
Immunogen Tanezumab

Introduction to Tanezumab ELISA Kit

Tanezumab is a humanized monoclonal antibody that targets nerve growth factor (NGF), a protein involved in the growth, maintenance, and repair of nerve cells. It is currently being developed as a potential therapy for chronic pain conditions, such as osteoarthritis and chronic low back pain. The Tanezumab ELISA Kit is a highly sensitive and specific tool used to measure the levels of Tanezumab in biological samples. In this article, we will discuss the structure, activity, and application of the Tanezumab ELISA Kit.

Structure of Tanezumab ELISA Kit

The Tanezumab ELISA Kit is composed of several components, including microtiter plates, Tanezumab-specific antibodies, and detection reagents. The microtiter plates are coated with a specific antibody that captures Tanezumab in the sample. The Tanezumab-specific antibodies are labeled with an enzyme, such as horseradish peroxidase (HRP), which produces a color change when exposed to the detection reagents. This color change can then be measured using a spectrophotometer, which determines the amount of Tanezumab in the sample.

Activity of Tanezumab ELISA Kit

The Tanezumab ELISA Kit works on the principle of antigen-antibody binding. When a sample containing Tanezumab is added to the microtiter plate, the Tanezumab-specific antibodies bind to the Tanezumab present in the sample. After washing away any unbound components, the detection reagents are added, which react with the enzyme-labeled antibodies. This reaction produces a color change that is directly proportional to the amount of Tanezumab present in the sample. The intensity of the color is measured using a spectrophotometer, and the concentration of Tanezumab in the sample is calculated using a standard curve.

Application of Tanezumab ELISA Kit

The Tanezumab ELISA Kit has multiple applications in the field of drug development and clinical research. It is primarily used to measure the levels of Tanezumab in biological samples, such as serum, plasma, and tissue homogenates. This allows researchers to monitor the pharmacokinetics of Tanezumab and evaluate its efficacy in clinical trials. The Tanezumab ELISA Kit can also be used to screen potential drug candidates that target NGF, as it can accurately measure the levels of Tanezumab in the presence of other NGF-targeting compounds.

The Tanezumab ELISA Kit is also a valuable tool in preclinical research, as it can be used to measure the levels of Tanezumab in animal models. This allows researchers to determine the appropriate dosage and treatment regimen for Tanezumab before moving on to human trials. Additionally, the Tanezumab ELISA Kit can be used to study the distribution and elimination of Tanezumab in different tissues and organs, providing valuable insights into its mechanism of action.

Conclusion

In conclusion, the Tanezumab ELISA Kit is a highly sensitive and specific tool for measuring the levels of Tanezumab in biological samples. Its structure, activity, and application make it an essential component in the development and evaluation of Tanezumab as a potential therapy for chronic pain conditions. As research on Tanezumab continues, the Tanezumab ELISA Kit will play a crucial role in advancing our understanding of this promising therapeutic target.

Tanezumab ELISA Kit

There are no reviews yet.

Be the first to review “Tanezumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products