Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tamrintamab Biosimilar – Anti-DPEP3, MBD3 mAb – Research Grade

  • PX-TA1554-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, lambda

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tamrintamab Biosimilar - Anti-DPEP3, MBD3 mAb - Research Grade

Product name Tamrintamab Biosimilar - Anti-DPEP3, MBD3 mAb - Research Grade
Uniprot ID Q9H4B8
Source CAS 2148325-59-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tamrintamab ,SC-003 mAb,SC-Mab003,SC34.28ss1,DPEP3, MBD3,anti-DPEP3, MBD3
Reference PX-TA1554
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-lambda
Clonality Monoclonal Antibody
Product name Tamrintamab Biosimilar - Anti-DPEP3, MBD3 mAb - Research Grade
Uniprot ID Q9H4B8
Source CAS 2148325-59-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tamrintamab ,SC-003 mAb,SC-Mab003,SC34.28ss1,DPEP3, MBD3,anti-DPEP3, MBD3
Reference PX-TA1554
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-lambda
Clonality Monoclonal Antibody
Product name PX-TA1554-50
Uniprot ID Q9H4B8
Source CAS 2148325-59-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tamrintamab ,SC-003 mAb,SC-Mab003,SC34.28ss1,DPEP3, MBD3,anti-DPEP3, MBD3
Reference PX-TA1554
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, lambda
Clonality Monoclonal Antibody

Tamrintamab Biosimilar: A Promising Antibody for Targeting DPEP3 and MBD3

Tamrintamab Biosimilar is a novel antibody that has shown great potential as a therapeutic agent in various diseases. This biosimilar is specifically designed to target two important proteins, DPEP3 and MBD3, which play crucial roles in various cellular processes. In this article, we will discuss the structure, activity, and potential applications of Tamrintamab Biosimilar in detail.

The Structure of Tamrintamab Biosimilar

Tamrintamab Biosimilar is a monoclonal antibody (mAb) that is produced by recombinant DNA technology. It is a biosimilar of the FDA-approved drug, Tamrintamab, which is used for the treatment of various cancers. The biosimilar has a similar structure to Tamrintamab, with slight differences in the amino acid sequence. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains are further divided into four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains have one constant region (CL) and one variable region (VL).

The variable regions of Tamrintamab Biosimilar are responsible for its specificity towards the target proteins, DPEP3 and MBD3. These regions contain hypervariable loops, also known as complementarity-determining regions (CDRs), which interact with the target proteins. The constant regions of the biosimilar are responsible for its effector functions, such as complement activation and antibody-dependent cellular cytotoxicity (ADCC).

The Activity of Tamrintamab Biosimilar

Tamrintamab Biosimilar is a potent inhibitor of DPEP3 and MBD3, which are important therapeutic targets in various diseases. DPEP3 is a membrane-bound metalloprotease that is overexpressed in many cancers, including breast, lung, and colon cancer. It promotes tumor growth and metastasis by cleaving extracellular matrix proteins and activating growth factors. MBD3, on the other hand, is a component of the nucleosome remodeling and deacetylase (NuRD) complex, which regulates gene expression and cell differentiation. Dysregulation of MBD3 has been linked to various diseases, including cancer, autoimmune disorders, and neurological disorders.

Tamrintamab Biosimilar binds to DPEP3 and MBD3 with high affinity and specificity, inhibiting their activity and downstream signaling pathways. This leads to the suppression of tumor growth and metastasis, as well as the modulation of immune responses and cellular differentiation. The biosimilar has also been shown to induce apoptosis (programmed cell death) in cancer cells, further contributing to its anti-tumor activity.

Potential Applications of Tamrintamab Biosimilar

Tamrintamab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various cancers, including breast, lung, and colon cancer. It has also shown potential in the treatment of autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis, due to its ability to modulate immune responses. In addition, the biosimilar has shown potential in the treatment of neurological disorders, such as Alzheimer’s disease, by targeting MBD3 and regulating gene expression.

Moreover, the biosimilar has the potential to be used in combination with other therapies, such as chemotherapy and immunotherapy, to enhance their efficacy and minimize side effects. Its high specificity towards DPEP3 and MBD3 makes it a promising candidate for targeted therapy, with minimal off-target effects.

Conclusion

Tamrintamab Biosimilar is a novel antibody that specifically targets DPEP3 and MBD3, two important proteins involved in various diseases. Its unique structure and potent activity make it a

SEC-HPLC of Tamrintamab Biosimilar - Anti-DPEP3; MBD3 mAb - Research Grade

SEC-HPLC of Tamrintamab  Biosimilar - Anti-DPEP3; MBD3 mAb - Research Grade

Tamrintamab Biosimilar - Anti-DPEP3; MBD3 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Tamrintamab Biosimilar - Anti-DPEP3; MBD3 mAb - Research Grade

SDS-PAGE for Tamrintamab  Biosimilar - Anti-DPEP3; MBD3 mAb - Research Grade

Tamrintamab Biosimilar - Anti-DPEP3; MBD3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tamrintamab  Biosimilar - Anti-DPEP3, MBD3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tamrintamab Biosimilar – Anti-DPEP3, MBD3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products