Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Staphylococcus AmiR1R2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Staphylococcus
Molecular weight:
40.59 kDa

€210.00

50ug + 210 loyalty points
Unknown Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Staphylococcus AmiR1R2 Recombinant Protein

Staphylococcus AmiR1R2 Recombinant Protein

Product name Staphylococcus AmiR1R2 Recombinant Protein
Origin species Staphylococcus
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLIKMGKVAPWGTQSTTTPTTPSKPTTPSKPSTGKLTVAANNGVAQIKPTNSGLYTTVYDKTGKATNEVQKTFAVSKTATLGNQKFYLVQDYNSGNKFGWVKEGDVVYNTAKSPVNVNQSYSIKPGTKLYTVPWGTSKQVAGSVSGSGNQTFKASKQQQIDKSIYLYGSVNGKSGWVSKAYLVDTAKPTPTPTPKPSTPTTNNKLTVSSLNGVAQINAKNNGLFTTVYDKTGKPTKEVQKTFAVTK
Molecular weight 40.59 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession KEK49756.1
Spec:Entrez GeneID 12330922
Spec:SwissProtID D9RNW1
NCBI Reference KEK49756.1
Aliases /Synonyms AmiR1R2, Bifunctional N-acetylmuramoyl-L-alanine amidase/endo-beta-N-acetylglucosaminidase, Atl
Reference PX-P2063
Note For research use only
Molecular Constructor
Unknown Yes
Product name Staphylococcus AmiR1R2 Recombinant Protein
Origin species Staphylococcus
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLIKMGKVAPWGTQSTTTPTTPSKPTTPSKPSTGKLTVAANNGVAQIKPTNSGLYTTVYDKTGKATNEVQKTFAVSKTATLGNQKFYLVQDYNSGNKFGWVKEGDVVYNTAKSPVNVNQSYSIKPGTKLYTVPWGTSKQVAGSVSGSGNQTFKASKQQQIDKSIYLYGSVNGKSGWVSKAYLVDTAKPTPTPTPKPSTPTTNNKLTVSSLNGVAQINAKNNGLFTTVYDKTGKPTKEVQKTFAVTK
Molecular weight 40.59 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession KEK49756.1
Spec:Entrez GeneID 12330922
Spec:SwissProtID D9RNW1
NCBI Reference KEK49756.1
Aliases /Synonyms AmiR1R2, Bifunctional N-acetylmuramoyl-L-alanine amidase/endo-beta-N-acetylglucosaminidase, Atl
Reference PX-P2063
Note For research use only
Molecular Constructor
Unknown Yes

There are no reviews yet.

Be the first to review “Staphylococcus AmiR1R2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products