Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Staphylococcus 6His-Protein A

Host species:
Escherichia coli (E.coli)
Origin species:
Staphylococcus
Uniprot ID:
P38507
Molecular weight:
33.83 KDa

567.00

10mg + 567 loyalty points
Partial Yes
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Staphylococcus 6His-Protein A

Product name Staphylococcus 6His-Protein A
Uniprot ID P38507
Uniprot link http://www.uniprot.org/uniprot/P38507
Origin species Staphylococcus
Expression system Procaryotic expression
Raw Antigen Sequence MGAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLP
Molecular weight 33.83 KDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:SwissProtID P38507
NCBI Reference EYF82342.1
Aliases /Synonyms 6His-Protein A
Reference PX-P2101
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Staphylococcus 6His-Protein A”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products