Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

SeV Nucleoprotein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Sendai virus (SeV)
Uniprot ID:
O57286

Original price was: €280.00.Current price is: €228.00.

50ug 19% OFF + 228 loyalty points
Gly413–Ile524 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

SeV Nucleoprotein, C-His

Product name ARO-P18763-100
Uniprot ID O57286
Origin species Sendai virus (SeV)
Expression system Prokaryotic expression
Raw Antigen Sequence GGGAIEVALDNADIDLEPEAHTDQDARGWGGDSGDRWARSMGSGHFITLHGAERLEEETNDEDVSDIERRIARRLAERRQEDATTHEDEGRNNGVDHDEEDDAAAAAGMGGI
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly413-Ile524
Aliases /Synonyms Nucleoprotein, Nucleocapsid protein, NP, Protein N, N, NP
Reference ARO-P18763
Note For research use only.
Molecular Constructor
Gly413–Ile524 His
Product name ARO-P18763-1MG
Uniprot ID O57286
Origin species Sendai virus (SeV)
Expression system Prokaryotic expression
Raw Antigen Sequence GGGAIEVALDNADIDLEPEAHTDQDARGWGGDSGDRWARSMGSGHFITLHGAERLEEETNDEDVSDIERRIARRLAERRQEDATTHEDEGRNNGVDHDEEDDAAAAAGMGGI
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly413-Ile524
Aliases /Synonyms Nucleoprotein, Nucleocapsid protein, NP, Protein N, N, NP
Reference ARO-P18763
Note For research use only.
Molecular Constructor
Gly413–Ile524 His
Product name ARO-P18763-50
Uniprot ID O57286
Origin species Sendai virus (SeV)
Expression system Prokaryotic expression
Raw Antigen Sequence GGGAIEVALDNADIDLEPEAHTDQDARGWGGDSGDRWARSMGSGHFITLHGAERLEEETNDEDVSDIERRIARRLAERRQEDATTHEDEGRNNGVDHDEEDDAAAAAGMGGI
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly413-Ile524
Aliases /Synonyms Nucleoprotein, Nucleocapsid protein, NP, Protein N, N, NP
Reference ARO-P18763
Note For research use only.
Molecular Constructor
Gly413–Ile524 His

There are no reviews yet.

Be the first to review “SeV Nucleoprotein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products