Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Seniprutug Biosimilar – Anti-TRBV9 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Seniprutug Biosimilar - Anti-TRBV9 mAb - Research Grade

Product name PX-TA2138-50
Uniprot ID A0A0B4J1U6
Source CAS: 2484772-72-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIHYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2138
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Seniprutug Biosimilar - Anti-TRBV9 mAb - Research Grade
Uniprot ID A0A0B4J1U6
Source CAS: 2484772-72-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIHYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2138
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Seniprutug Biosimilar - Anti-TRBV9 mAb - Research Grade
Uniprot ID A0A0B4J1U6
Source CAS: 2484772-72-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIHYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2138
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Seniprutug Biosimilar – Anti-TRBV9 mAb is a novel biosimilar antibody that has been developed for the treatment of various diseases. This antibody targets the TRBV9 protein, which is a therapeutic target for several autoimmune and inflammatory conditions. In this article, we will discuss the structure, activity, and applications of Seniprutug Biosimilar – Anti-TRBV9 mAb in detail.

Structure of Seniprutug Biosimilar – Anti-TRBV9 mAb

Seniprutug Biosimilar – Anti-TRBV9 mAb is a monoclonal antibody, meaning it is produced by a single type of immune cell. It is a biosimilar of the original anti-TRBV9 mAb, which means it has a highly similar structure and function to the original antibody. The antibody is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The variable regions of the antibody, responsible for binding to the TRBV9 protein, are located at the tips of the heavy and light chains.

Activity of Seniprutug Biosimilar – Anti-TRBV9 mAb

The main activity of Seniprutug Biosimilar – Anti-TRBV9 mAb is to bind to the TRBV9 protein and inhibit its function. TRBV9 is a protein that is expressed on the surface of certain immune cells, such as T cells and natural killer cells. When activated, TRBV9 can promote inflammation and autoimmune responses. By binding to TRBV9, Seniprutug Biosimilar – Anti-TRBV9 mAb blocks its activity and prevents the immune cells from causing damage to the body.

Applications of Seniprutug Biosimilar – Anti-TRBV9 mAb

Seniprutug Biosimilar – Anti-TRBV9 mAb has potential applications in the treatment of various diseases. Its main therapeutic target, TRBV9, has been implicated in several autoimmune and inflammatory conditions, making Seniprutug Biosimilar – Anti-TRBV9 mAb a promising candidate for these diseases. Some of the potential applications of this antibody are discussed below.

1. Rheumatoid Arthritis Rheumatoid arthritis is an autoimmune disease that causes inflammation and damage to the joints. TRBV9 has been shown to play a role in the development of this condition, making it a potential therapeutic target. Seniprutug Biosimilar – Anti-TRBV9 mAb can inhibit the activity of TRBV9 and reduce inflammation in the joints, providing relief to patients with rheumatoid arthritis.

2. Multiple Sclerosis Multiple sclerosis is a neurological disorder characterized by inflammation and damage to the central nervous system. TRBV9 has been found to be involved in the development of this condition, making it a potential target for treatment. Seniprutug Biosimilar – Anti-TRBV9 mAb can block the activity of TRBV9 and reduce inflammation in the central nervous system, potentially slowing down the progression of multiple sclerosis.

3. Psoriasis Psoriasis is a chronic inflammatory skin disorder that is caused by an overactive immune system. TRBV9 has been shown to play a role in the development of psoriasis, making it a potential therapeutic target. By binding to TRBV9, Seniprutug Biosimilar – Anti-TRBV9 mAb can reduce inflammation in the skin and improve symptoms of psoriasis.

4. Inflammatory Bowel Disease Inflammatory bowel disease (IBD) is a group of disorders that cause inflammation in the digestive tract. TRBV9 has been implicated in the development of IBD, making it a potential target for treatment. Seniprutug Biosimilar – Anti-TRBV9 mAb can inhibit the activity of TRBV9 and reduce inflammation in the digestive tract, potentially improving symptoms of IBD.

Conclusion

In summary, Seniprutug Biosimilar – Anti-TRBV9 mAb is a novel biosimilar antibody that targets the TRBV9 protein, which is involved in various autoimmune and inflammatory conditions. Its structure, activity, and potential applications make it a promising candidate for the treatment of these diseases. Further research and clinical trials

SDS-PAGE for Research Grade Seniprutug

SDS-PAGE for Research Grade Seniprutug

Research Grade Seniprutug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Seniprutug Biosimilar - Anti-TRBV9 mAb - Research Grade

There are no reviews yet.

Be the first to review “Seniprutug Biosimilar – Anti-TRBV9 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products