Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rolinsatamab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Rolinsatamab ELISA Kit

Rolinsatamab ELISA Kit

Product name Rolinsatamab ELISA Kit
Uniprot ID P16471
Raw Antigen Sequence MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX199
Note For research use only.
Sample type Plasma, Serum
Target Rolinsatamab
Immunogen Rolinsatamab

Introduction

The Rolinsatamab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Rolinsatamab, a novel antibody that has shown promising results as a therapeutic target for various diseases. This kit is designed to provide accurate and reliable results for researchers and clinicians in the field of immunology and drug development.

Structure of Rolinsatamab

Rolinsatamab is a monoclonal antibody that binds to the CD19 protein on the surface of B cells. It is composed of two identical heavy chains and two identical light chains, linked together by disulfide bonds. The heavy chains consist of a variable region that recognizes the CD19 antigen and a constant region that determines the antibody’s effector functions. The light chains also have a variable region for antigen recognition and a constant region for stability.

The specific structure of Rolinsatamab makes it an ideal therapeutic target as it can bind to and neutralize CD19, which is overexpressed on the surface of B cells in various diseases such as B cell lymphomas and leukemias.

Activity of Rolinsatamab

Rolinsatamab has a unique mechanism of action that sets it apart from other CD19-targeted therapies. It not only binds to CD19, but also induces antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). This means that Rolinsatamab can recruit immune cells and activate the complement system to kill CD19-positive cells.

Furthermore, Rolinsatamab has been engineered with a modified Fc region that enhances its binding affinity to the Fc receptors on immune cells, leading to increased ADCC activity. This modification also reduces the binding to Fc gamma receptor IIb (FcγRIIb), which is a negative regulator of immune response, resulting in prolonged activation of immune cells.

Application of Rolinsatamab

Rolinsatamab has shown promising results in preclinical and clinical studies for the treatment of B cell malignancies such as non-Hodgkin’s lymphoma and chronic lymphocytic leukemia. It has also been investigated for its potential in autoimmune diseases such as rheumatoid arthritis and multiple sclerosis.

The Rolinsatamab ELISA Kit is a valuable tool for researchers and clinicians to measure the levels of Rolinsatamab in patient samples and monitor its efficacy in clinical trials. It can also be used to assess the pharmacokinetics of Rolinsatamab, which is crucial for determining the optimal dosing regimen for patients.

In addition, the high sensitivity and specificity of this kit make it a useful tool for drug development and quality control. It can be used to screen potential candidate drugs that target CD19 and evaluate their binding affinity to the CD19 antigen.

Conclusion

The Rolinsatamab ELISA Kit is a reliable and accurate tool for the detection and quantification of Rolinsatamab, a novel antibody with a unique mechanism of action. Its high sensitivity and specificity make it an essential tool for researchers and clinicians in the field of immunology and drug development. With the growing interest in CD19-targeted therapies, the Rolinsatamab ELISA Kit will continue to play a crucial role in the development and evaluation of this promising therapeutic target.

Rolinsatamab ELISA Kit

There are no reviews yet.

Be the first to review “Rolinsatamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products