Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rivabazumab Biosimilar – Anti-PcrV mAb – Research Grade

  • PX-TA1416-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
Fab'-G1-kappa

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade

Product name Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade
Uniprot ID O30527
Source CAS 1627519-84-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Rivabazumab,BA1126,PcrV,anti-PcrV
Reference PX-TA1416
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-kappa
Clonality Monoclonal Antibody
Product name Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade
Uniprot ID O30527
Source CAS 1627519-84-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Rivabazumab,BA1126,PcrV,anti-PcrV
Reference PX-TA1416
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1416-50
Uniprot ID O30527
Source CAS 1627519-84-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Rivabazumab,BA1126,PcrV,anti-PcrV
Reference PX-TA1416
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-kappa
Clonality Monoclonal Antibody

General information on Anti-PcrV[Pseudomonas aeruginosa,Gram negative bacteria] (Rivabazumab) Monoclonal Antibody

Rivabazumab has been investigated for the treatment and prevention of Pseudomonas aeruginosa infections.

SEC-HPLC of Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade

SEC-HPLC of Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade

Rivabazumab Biosimilar - Anti-PcrV mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Rivabazumab Biosimilar - Anti-PcrV mAb - Research Grade

There are no reviews yet.

Be the first to review “Rivabazumab Biosimilar – Anti-PcrV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products