Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Rhesus monkey IL37 – Interleukin 1 Zeta (IL1z) recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Rhesus monkey
Molecular weight:
27.71kDa

€329.00

100ug + 329 loyalty points
Full-length Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein

Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein

Product name Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein
Origin species Rhesus monkey
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLVPRGSMSNNSTLKMSFVGENSGVKTGSEDWEKDEPQCYSEKDEPQCYSEDPAGSPLEPGPSLPSMNFVHTSPKVKNLNPKKFSIHDQDHKVLVVDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLSCDKDKGQSHPSLQLKKKKLMKLAALKESARRPFIFYRAQVGSRNTLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Molecular weight 27.71kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
NCBI Reference XP_011722821.1
Aliases /Synonyms IL1F7, IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1H4, IL1RP1, Interleukin 37, Interleukin-1-Related Protein, Interleukin 1 Family, Member 7
Reference PX-P4063
Note For research use only
Molecular Constructor
Full-length Yes
Product name Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein
Origin species Rhesus monkey
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLVPRGSMSNNSTLKMSFVGENSGVKTGSEDWEKDEPQCYSEKDEPQCYSEDPAGSPLEPGPSLPSMNFVHTSPKVKNLNPKKFSIHDQDHKVLVVDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLSCDKDKGQSHPSLQLKKKKLMKLAALKESARRPFIFYRAQVGSRNTLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Molecular weight 27.71kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
NCBI Reference XP_011722821.1
Aliases /Synonyms IL1F7, IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1H4, IL1RP1, Interleukin 37, Interleukin-1-Related Protein, Interleukin 1 Family, Member 7
Reference PX-P4063
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Rhesus monkey IL37 – Interleukin 1 Zeta (IL1z) recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products