Name: Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein
SKU: PX-P4063-10
Availability: InStock

Product name	Rhesus monkey IL37 - Interleukin 1 Zeta (IL1z) recombinant protein
Origin species	Rhesus monkey
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGLVPRGSMSNNSTLKMSFVGENSGVKTGSEDWEKDEPQCYSEKDEPQCYSEDPAGSPLEPGPSLPSMNFVHTSPKVKNLNPKKFSIHDQDHKVLVVDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLSCDKDKGQSHPSLQLKKKKLMKLAALKESARRPFIFYRAQVGSRNTLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Molecular weight	27.71kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Delivery condition	Dry Ice
Delivery lead time in business days	2-3
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Full-length
NCBI Reference	XP_011722821.1
Aliases /Synonyms	IL1F7, IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1H4, IL1RP1, Interleukin 37, Interleukin-1-Related Protein, Interleukin 1 Family, Member 7
Reference	PX-P4063
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Rhesus monkey IL37 – Interleukin 1 Zeta (IL1z) recombinant protein”

size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Rhesus monkey IL37 – Interleukin 1 Zeta (IL1z) recombinant protein