Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Rat SCNN1A/SCNN1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Rat
Uniprot ID:
P37089
Molecular weight:
32.25 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Glu132–Asp391
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Rat SCNN1A/SCNN1 Protein, N-His

Product name ARO-P12656-100
Uniprot ID P37089
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence EEYLSYPVSLNINLNSDKLVFPAVTVCTLNPYRYTEIKEELEELDRITEQTLFDLYKYNSSYTRQAGARRRSSRDLLGAFPHPLQRLRTPPPPYSGRTARSGSSSVRDNNPQVDRKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLSDTSPALEEEALGNFIFTCRFNQAPCNQANYSKFHHPMYGNCYTFNDKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDD
Molecular weight 32.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu132-Asp391
Aliases /Synonyms Amiloride-sensitive sodium channel subunit alpha; Alpha-NaCH; Epithelial Na(+) channel subunit alpha; Alpha-ENaC; Nonvoltage-gated sodium channel 1 subunit alpha; SCNEA; Scnn1a; Renac
Reference ARO-P12656
Note For research use only.
Molecular Constructor
Glu132–Asp391
Product name ARO-P12656-1MG
Uniprot ID P37089
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence EEYLSYPVSLNINLNSDKLVFPAVTVCTLNPYRYTEIKEELEELDRITEQTLFDLYKYNSSYTRQAGARRRSSRDLLGAFPHPLQRLRTPPPPYSGRTARSGSSSVRDNNPQVDRKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLSDTSPALEEEALGNFIFTCRFNQAPCNQANYSKFHHPMYGNCYTFNDKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDD
Molecular weight 32.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu132-Asp391
Aliases /Synonyms Amiloride-sensitive sodium channel subunit alpha; Alpha-NaCH; Epithelial Na(+) channel subunit alpha; Alpha-ENaC; Nonvoltage-gated sodium channel 1 subunit alpha; SCNEA; Scnn1a; Renac
Reference ARO-P12656
Note For research use only.
Molecular Constructor
Glu132–Asp391
Product name ARO-P12656-50
Uniprot ID P37089
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence EEYLSYPVSLNINLNSDKLVFPAVTVCTLNPYRYTEIKEELEELDRITEQTLFDLYKYNSSYTRQAGARRRSSRDLLGAFPHPLQRLRTPPPPYSGRTARSGSSSVRDNNPQVDRKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLSDTSPALEEEALGNFIFTCRFNQAPCNQANYSKFHHPMYGNCYTFNDKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDD
Molecular weight 32.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu132-Asp391
Aliases /Synonyms Amiloride-sensitive sodium channel subunit alpha; Alpha-NaCH; Epithelial Na(+) channel subunit alpha; Alpha-ENaC; Nonvoltage-gated sodium channel 1 subunit alpha; SCNEA; Scnn1a; Renac
Reference ARO-P12656
Note For research use only.
Molecular Constructor
Glu132–Asp391

The Structure of Recombinant Rat SCNN1A/SCNN1 Protein

Recombinant Rat SCNN1A/SCNN1 protein is a synthetic form of the rat epithelial sodium channel (ENaC) that is made using recombinant DNA technology. This protein is composed of three subunits: alpha, beta, and gamma, which are encoded by the SCNN1A, SCNN1B, and SCNN1G genes, respectively. Each subunit has a unique structure and function, but they all work together to form a functional sodium channel.

The alpha subunit is the largest and most important subunit of ENaC, as it contains the ion-conducting pore. It has two transmembrane domains, with the N-terminus located on the extracellular side and the C-terminus on the intracellular side. The beta and gamma subunits are smaller and have one transmembrane domain each, with their N-termini also facing the extracellular side. These subunits are connected by disulfide bonds and form a heterotrimeric complex that is essential for the proper functioning of ENaC.

The Activity of Recombinant Rat SCNN1A/SCNN1 Protein

Recombinant Rat SCNN1A/SCNN1 protein has the same activity as the native rat ENaC, which is to regulate sodium transport across epithelial cells. This protein is predominantly found in the kidney, lung, and colon, where it plays a crucial role in maintaining sodium and fluid balance in the body. ENaC is an ion channel that allows the selective transport of sodium ions from the extracellular environment into the cell. This process is essential for maintaining proper blood pressure, electrolyte balance, and hydration levels.

The activity of ENaC is regulated by various factors, including hormones, such as aldosterone, and intracellular signaling pathways. When activated, ENaC opens up, allowing sodium ions to flow into the cell. This influx of sodium then leads to the movement of water, resulting in the reabsorption of fluid into the body. On the other hand, when ENaC is inhibited, sodium and water are excreted, leading to a decrease in blood pressure and fluid loss.

The Application of Recombinant Rat SCNN1A/SCNN1 Protein

Recombinant Rat SCNN1A/SCNN1 protein has various applications in both research and medical fields. One of its primary uses is in the study of ENaC function and regulation. This protein can be used to investigate the effects of different factors, such as hormones and signaling pathways, on ENaC activity. It can also be used to study the role of ENaC in various physiological processes, such as sodium and fluid balance, as well as in diseases, such as hypertension and cystic fibrosis.

In the medical field, recombinant Rat SCNN1A/SCNN1 protein has potential therapeutic applications. For instance, in patients with cystic fibrosis, the function of ENaC is impaired, leading to a buildup of thick mucus in the lungs. Recombinant Rat SCNN1A/SCNN1 protein can be used to study the mechanisms of ENaC dysfunction in cystic fibrosis and develop potential treatments to restore its activity.

Moreover, recombinant Rat SCNN1A/SCNN1 protein can also be used to develop diagnostic tools for various diseases. For example, in patients with primary aldosteronism, a condition characterized by excessive aldosterone production, ENaC activity is increased. By using recombinant Rat SCNN1A/SCNN1 protein, researchers can develop assays to measure ENaC activity and diagnose primary aldosteronism.

In conclusion, recombinant Rat SCNN1A/SCNN1 protein is a valuable tool for studying the structure, activity, and application of ENaC. Its synthetic nature allows for consistent and reproducible results, making it an essential component in research and medical settings. With its potential to advance our understanding of

Recombinant Rat SCNN1A/SCNN1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Rat SCNN1A/SCNN1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products