Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Rat CFMNter Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Rat
Uniprot ID:
Q6AXS9
Molecular weight:
39,20 kDa

€329.00

100ug + 329 loyalty points
Partial No
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Rat CFMNter Recombinant Protein

Rat CFMNter Recombinant Protein

Product name Rat CFMNter Recombinant Protein
Uniprot ID Q6AXS9
Uniprot link http://www.uniprot.org/uniprot/Q6AXS9
Origin species Rat
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMVGRLSLQD VPELVDTKKKGDGVLDSPDSGLPPSPSPSHWGLAAATGGGGERAPVAGTLEPDATVTSVVPNPASLSHSLAGICSPRLCP LSFGEGVEFDPLPPKEIKYTSSVKYDSERHF
Molecular weight 39,20 kDa
Protein delivered with Tag? No
Purity estimated 80% (with degraded bands)
Buffer TrisHCl 50mM if elution. TrisHCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM if cleavage
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_001007612.1
Spec:Entrez GeneID 287534
Spec:NCBI Gene Aliases RGD1359691
Spec:SwissProtID Q6AXS9
NCBI Reference NP_001007612.1
Aliases /Synonyms CFMNter, protein FAM101B, Refilin-B, Regulator of filamin protein B, RefilinB
Reference PX-P1079
Note For research use only
Molecular Constructor
Partial No
Product name Rat CFMNter Recombinant Protein
Uniprot ID Q6AXS9
Uniprot link http://www.uniprot.org/uniprot/Q6AXS9
Origin species Rat
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMVGRLSLQD VPELVDTKKKGDGVLDSPDSGLPPSPSPSHWGLAAATGGGGERAPVAGTLEPDATVTSVVPNPASLSHSLAGICSPRLCP LSFGEGVEFDPLPPKEIKYTSSVKYDSERHF
Molecular weight 39,20 kDa
Protein delivered with Tag? No
Purity estimated 80% (with degraded bands)
Buffer TrisHCl 50mM if elution. TrisHCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM if cleavage
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_001007612.1
Spec:Entrez GeneID 287534
Spec:NCBI Gene Aliases RGD1359691
Spec:SwissProtID Q6AXS9
NCBI Reference NP_001007612.1
Aliases /Synonyms CFMNter, protein FAM101B, Refilin-B, Regulator of filamin protein B, RefilinB
Reference PX-P1079
Note For research use only
Molecular Constructor
Partial No

There are no reviews yet.

Be the first to review “Rat CFMNter Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products