Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Pyrococcus horikoshii cutA, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Pyrococcus horikoshii
Uniprot ID:
O58720
Molecular weight:
39.05 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Met1–Lys102
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Pyrococcus horikoshii cutA, N-His

Product name ARO-P12841-100
Uniprot ID O58720
Origin species Pyrococcus horikoshii
Expression system Prokaryotic expression
Raw Antigen Sequence MIIVYTTFPDWESAEKVVKTLLKERLIACANLREHRAFYWWEGKIEEDKEVGAILKTREDLWEELKERIKELHPYDVPAIIRIDVDDVNEDYLKWLIEETKK
Molecular weight 39.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys102
Aliases /Synonyms Divalent-cation tolerance protein CutA, cutA, PH0992
Reference ARO-P12841
Note For research use only.
Molecular Constructor
Met1–Lys102
Product name ARO-P12841-1MG
Uniprot ID O58720
Origin species Pyrococcus horikoshii
Expression system Prokaryotic expression
Raw Antigen Sequence MIIVYTTFPDWESAEKVVKTLLKERLIACANLREHRAFYWWEGKIEEDKEVGAILKTREDLWEELKERIKELHPYDVPAIIRIDVDDVNEDYLKWLIEETKK
Molecular weight 39.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys102
Aliases /Synonyms Divalent-cation tolerance protein CutA, cutA, PH0992
Reference ARO-P12841
Note For research use only.
Molecular Constructor
Met1–Lys102
Product name ARO-P12841-50
Uniprot ID O58720
Origin species Pyrococcus horikoshii
Expression system Prokaryotic expression
Raw Antigen Sequence MIIVYTTFPDWESAEKVVKTLLKERLIACANLREHRAFYWWEGKIEEDKEVGAILKTREDLWEELKERIKELHPYDVPAIIRIDVDDVNEDYLKWLIEETKK
Molecular weight 39.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys102
Aliases /Synonyms Divalent-cation tolerance protein CutA, cutA, PH0992
Reference ARO-P12841
Note For research use only.
Molecular Constructor
Met1–Lys102

Introduction to Recombinant Pyrococcus horikoshii cutA

Recombinant Pyrococcus horikoshii cutA is a highly specialized protein that has been genetically engineered for use in various scientific and medical applications. This protein is derived from the extremophilic bacterium Pyrococcus horikoshii, which is known for its ability to thrive in extreme conditions such as high temperatures and acidic environments.

Structure of Recombinant Pyrococcus horikoshii cutA

The structure of Recombinant Pyrococcus horikoshii cutA is composed of a single polypeptide chain that contains 160 amino acid residues. This protein is classified as a metal-binding protein, as it contains a conserved metal binding motif known as the cutA box. This motif is essential for the protein’s function and is responsible for its ability to bind to various metal ions.

The three-dimensional structure of Recombinant Pyrococcus horikoshii cutA has been determined through X-ray crystallography, revealing a unique fold with a central beta-sheet surrounded by alpha-helices. This structure is highly stable and allows the protein to withstand extreme conditions, making it an ideal candidate for various applications.

Activity of Recombinant Pyrococcus horikoshii cutA

Recombinant Pyrococcus horikoshii cutA is a multifunctional protein with various activities that make it a valuable tool in scientific research. One of its main functions is its ability to bind to metal ions, particularly copper and zinc. This binding activity is crucial for the protein’s role in regulating metal homeostasis in cells.

In addition to its metal-binding activity, Recombinant Pyrococcus horikoshii cutA also exhibits antioxidant properties. It has been shown to scavenge free radicals and protect cells from oxidative damage, making it a potential therapeutic agent for conditions related to oxidative stress.

Furthermore, Recombinant Pyrococcus horikoshii cutA has been found to have chaperone activity, meaning it can help other proteins fold correctly and prevent them from forming aggregates. This activity is essential for maintaining proper protein function and preventing diseases associated with protein misfolding.

Applications of Recombinant Pyrococcus horikoshii cutA

Recombinant Pyrococcus horikoshii cutA has a wide range of applications in both scientific research and medical fields. Its metal-binding activity makes it a valuable tool for studying metal homeostasis and its role in various cellular processes. It has also been used in bioremediation, as its ability to bind to heavy metals can help remove them from contaminated environments.

In the medical field, Recombinant Pyrococcus horikoshii cutA has been studied for its potential as an antioxidant and anti-inflammatory agent. Its chaperone activity also makes it a promising candidate for the treatment of protein misfolding diseases, such as Alzheimer’s and Parkinson’s.

Another important application of Recombinant Pyrococcus horikoshii cutA is in the production of vaccines. As a recombinant protein, it can be easily produced in large quantities and used as an antigen to stimulate an immune response. This has been demonstrated in the development of a vaccine against Helicobacter pylori, a bacterium that causes stomach ulcers.

Conclusion

In conclusion, Recombinant Pyrococcus horikoshii cutA is a versatile protein with unique structural and functional properties. Its ability to withstand extreme conditions, bind to metals, and act as an antioxidant and chaperone make it a valuable tool in various scientific and medical applications. As research on this protein continues, it is likely that more potential uses will be discovered, further highlighting its importance in the field of biotechnology.

Recombinant Pyrococcus horikoshii cutA, N-His

There are no reviews yet.

Be the first to review “Recombinant Pyrococcus horikoshii cutA, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products