Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Protein A/SPA Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Staphylococcus aureus
Uniprot ID:
P02976
Molecular weight:
33.88 kDa

Original price was: €274.00.Current price is: €230.00.

50ug 16% OFF + 230 loyalty points
Ala37–Lys327
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Protein A/SPA Protein, C-His

Product name ARO-P12733-100
Uniprot ID P02976
Origin species Staphylococcus aureus
Expression system Prokaryotic expression
Raw Antigen Sequence AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 33.88 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala37-Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A, SpA, spa, Bacteria,Protein A
Reference ARO-P12733
Note For research use only.
Molecular Constructor
Ala37–Lys327
Product name ARO-P12733-1MG
Uniprot ID P02976
Origin species Staphylococcus aureus
Expression system Prokaryotic expression
Raw Antigen Sequence AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 33.88 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala37-Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A, SpA, spa, Bacteria,Protein A
Reference ARO-P12733
Note For research use only.
Molecular Constructor
Ala37–Lys327
Product name ARO-P12733-50
Uniprot ID P02976
Origin species Staphylococcus aureus
Expression system Prokaryotic expression
Raw Antigen Sequence AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 33.88 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala37-Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A, SpA, spa, Bacteria,Protein A
Reference ARO-P12733
Note For research use only.
Molecular Constructor
Ala37–Lys327

Introduction to Recombinant Protein A/SPA Protein

Recombinant Protein A/SPA Protein is a highly versatile protein that has been widely used in the field of biotechnology. This protein is derived from the bacterium Staphylococcus aureus and has been extensively studied for its unique structure and properties. In this article, we will explore the structure, activity, and application of Recombinant Protein A/SPA Protein in detail.

Structure of Recombinant Protein A/SPA Protein

Recombinant Protein A/SPA Protein is a 42 kDa protein consisting of 374 amino acids. It is composed of five immunoglobulin-binding domains (IgG-binding domains) and a non-specific binding domain. These domains are responsible for the protein’s ability to bind to immunoglobulins, specifically the Fc region of IgG antibodies. The protein also contains a cell wall binding domain that allows it to bind to the cell wall of Staphylococcus aureus.

Activity of Recombinant Protein A/SPA Protein

Recombinant Protein A/SPA Protein is known for its high affinity and specificity towards immunoglobulins, particularly IgG. This protein binds to the Fc region of IgG with a dissociation constant (Kd) of approximately 10^-9 M, making it one of the strongest known protein-ligand interactions. This strong binding affinity is due to the presence of multiple IgG-binding domains in the protein.

The non-specific binding domain of Recombinant Protein A/SPA Protein also contributes to its activity. This domain allows the protein to bind to a wide range of species and subclasses of IgG, making it a valuable tool in various applications.

Application of Recombinant Protein A/SPA Protein

Recombinant Protein A/SPA Protein has a wide range of applications in the field of biotechnology. Its ability to specifically bind to IgG antibodies makes it a useful tool in antibody purification and detection. The protein is commonly used in chromatography techniques, such as affinity chromatography, to purify monoclonal and polyclonal antibodies from complex mixtures.

In addition to purification, Recombinant Protein A/SPA Protein is also used in antibody labeling and detection assays. Its strong binding affinity for IgG allows for sensitive and specific detection of antibodies in various immunoassays, such as ELISA and Western blot.

Another important application of Recombinant Protein A/SPA Protein is in antibody-based therapies. The protein can be conjugated with drugs or toxins and targeted towards specific cells or tissues using antibodies. This targeted therapy approach has shown promising results in the treatment of various diseases, including cancer.

Furthermore, Recombinant Protein A/SPA Protein has also been used in the development of diagnostic tests for infectious diseases. Its ability to bind to a wide range of IgG subclasses allows for the detection of different types of antibodies in patient samples, making it a valuable tool in serological testing.

Conclusion

In conclusion, Recombinant Protein A/SPA Protein is a highly versatile protein with a unique structure and strong binding affinity for IgG antibodies. Its applications in antibody purification, labeling, detection, and therapy make it an essential tool in the field of biotechnology. With ongoing research and advancements, the potential uses of Recombinant Protein A/SPA Protein are continuously expanding, making it a valuable protein in the scientific community.

Recombinant Protein A/SPA Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Protein A/SPA Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products