Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse Ifna15 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q61718
Molecular weight:
21.62 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Cys24–Glu190
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse Ifna15 Protein, N-His

Product name ARO-P10534-100
Uniprot ID Q61718
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFRFPQEKVDAQQIQNAQAIPVLQELTQQVLNIFTSKDSSAAWDASLLDSFCNDLHQQLNDLKACVMQEVGVQEPPLTQEDYLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRAMSSSAKLLARLSEEKE
Molecular weight 21.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu190
Aliases /Synonyms Alpha-interferon, Interferon 1ai1, Interferon alpha 15, Predicted gene, OTTMUSG00000007655, Ifna15, Gm12597, If1ai1, MuIFN-alpha-A
Reference ARO-P10534
Note For research use only.
Molecular Constructor
Cys24–Glu190
Product name ARO-P10534-1MG
Uniprot ID Q61718
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFRFPQEKVDAQQIQNAQAIPVLQELTQQVLNIFTSKDSSAAWDASLLDSFCNDLHQQLNDLKACVMQEVGVQEPPLTQEDYLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRAMSSSAKLLARLSEEKE
Molecular weight 21.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu190
Aliases /Synonyms Alpha-interferon, Interferon 1ai1, Interferon alpha 15, Predicted gene, OTTMUSG00000007655, Ifna15, Gm12597, If1ai1, MuIFN-alpha-A
Reference ARO-P10534
Note For research use only.
Molecular Constructor
Cys24–Glu190
Product name ARO-P10534-50
Uniprot ID Q61718
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFRFPQEKVDAQQIQNAQAIPVLQELTQQVLNIFTSKDSSAAWDASLLDSFCNDLHQQLNDLKACVMQEVGVQEPPLTQEDYLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRAMSSSAKLLARLSEEKE
Molecular weight 21.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu190
Aliases /Synonyms Alpha-interferon, Interferon 1ai1, Interferon alpha 15, Predicted gene, OTTMUSG00000007655, Ifna15, Gm12597, If1ai1, MuIFN-alpha-A
Reference ARO-P10534
Note For research use only.
Molecular Constructor
Cys24–Glu190

Introduction

Recombinant Mouse Ifna15 Protein, also known as Interferon alpha-15, is a type I interferon protein that plays a crucial role in the innate immune response against viral infections. This protein is produced through recombinant DNA technology, allowing for large-scale production and purification for various research and therapeutic applications. In this article, we will explore the structure, activity, and applications of Recombinant Mouse Ifna15 Protein.

Structure of Recombinant Mouse Ifna15 Protein

Recombinant Mouse Ifna15 Protein is a 20 kDa protein consisting of 166 amino acids. It belongs to the type I interferon family and shares a high degree of sequence homology with other interferon alpha proteins. The primary structure of Ifna15 protein contains a signal peptide at the N-terminus, followed by a conserved cysteine-rich domain and a highly variable C-terminal region. The cysteine residues in the conserved domain are important for the formation of disulfide bonds, which contribute to the stability and activity of the protein.

The three-dimensional structure of Recombinant Mouse Ifna15 Protein has been determined through X-ray crystallography. It adopts a compact globular conformation, with the conserved cysteine-rich domain forming a four-helix bundle and the C-terminal region extending outwards. This structure is similar to other type I interferons and is essential for its biological activity.

Activity of Recombinant Mouse Ifna15 Protein

Recombinant Mouse Ifna15 Protein exerts its activity through binding to the interferon alpha receptor (IFNAR), a heterodimeric receptor complex consisting of IFNAR1 and IFNAR2 subunits. Upon binding, the receptor activates the Janus kinase/signal transducer and activator of transcription (JAK/STAT) signaling pathway, leading to the transcription of interferon-stimulated genes (ISGs).

The main function of Recombinant Mouse Ifna15 Protein is to induce an antiviral state in cells, making them resistant to viral infection. It also has immunomodulatory effects, such as enhancing the activity of natural killer cells and promoting the differentiation of T cells. Additionally, Ifna15 protein has been shown to have anti-proliferative and pro-apoptotic effects on certain cancer cells, making it a potential candidate for cancer therapy.

Applications of Recombinant Mouse Ifna15 Protein

Recombinant Mouse Ifna15 Protein has a wide range of applications in both research and therapeutic settings. In research, it is commonly used as a positive control in experiments studying the interferon signaling pathway and its effects on immune cells. It is also used to induce an antiviral state in cells for the study of viral infections.

Therapeutically, Recombinant Mouse Ifna15 Protein has been investigated as a potential treatment for viral infections, such as hepatitis B and C, and various types of cancer. It has also been studied for its potential in treating autoimmune diseases, such as multiple sclerosis and lupus. Clinical trials have shown promising results, with some patients showing improved outcomes after treatment with Recombinant Mouse Ifna15 Protein.

Conclusion

In summary, Recombinant Mouse Ifna15 Protein is a type I interferon with a conserved structure and important biological activity. Its ability to induce an antiviral state and modulate the immune response makes it a valuable tool in research and a potential therapeutic agent for various diseases. Continued research on this protein will further enhance our understanding of its structure and activity, leading to the development of novel treatments for a range of conditions.

Recombinant Mouse Ifna15 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse Ifna15 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products