Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human S100A8 Antibody (ABS1011)

Clonality:
Monoclonal Antibody
Isotype:
IgG2a, kappa

Original price was: €470.00.Current price is: €379.00.

100ug 19% OFF + 379 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human S100A8 Antibody (ABS1011)

Product name ARO-A17485-100
Uniprot ID P05109
Raw Antigen Sequence MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-S100A8, Anti-Mrp8, Anti-MRP-8
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name S100A8
Product name ARO-A17485-1MG
Uniprot ID P05109
Raw Antigen Sequence MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-S100A8, Anti-Mrp8, Anti-MRP-8
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name S100A8
Product name ARO-A17485-50
Uniprot ID P05109
Raw Antigen Sequence MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-S100A8, Anti-Mrp8, Anti-MRP-8
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name S100A8

SDS-PAGE for Anti-Human S100A8 Antibody (ABS1011)

SDS-PAGE for Anti-Human S100A8 Antibody (ABS1011)

Anti-Human S100A8 Antibody (ABS1011), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Human S100A8 Antibody (ABS1011)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products