Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse RGMB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q7TQ33
Molecular weight:
29.66 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Gly156–Arg404
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse RGMB Protein, N-His

Product name ARO-P11054-100
Uniprot ID Q7TQ33
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPR
Molecular weight 29.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly156-Arg404
Aliases /Synonyms DRG11-responsive axonal guidance and outgrowth of neurite, DRAGON, Rgmb, Repulsive guidance molecule B
Reference ARO-P11054
Note For research use only.
Molecular Constructor
Gly156–Arg404
Product name ARO-P11054-1MG
Uniprot ID Q7TQ33
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPR
Molecular weight 29.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly156-Arg404
Aliases /Synonyms DRG11-responsive axonal guidance and outgrowth of neurite, DRAGON, Rgmb, Repulsive guidance molecule B
Reference ARO-P11054
Note For research use only.
Molecular Constructor
Gly156–Arg404
Product name ARO-P11054-50
Uniprot ID Q7TQ33
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPR
Molecular weight 29.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly156-Arg404
Aliases /Synonyms DRG11-responsive axonal guidance and outgrowth of neurite, DRAGON, Rgmb, Repulsive guidance molecule B
Reference ARO-P11054
Note For research use only.
Molecular Constructor
Gly156–Arg404

Introduction to Recombinant Mouse RGMB Protein

Recombinant Mouse RGMB Protein is a highly versatile protein that plays a crucial role in various biological processes. This protein is produced through recombinant DNA technology, which involves combining genetic material from different sources to create a new protein. Recombinant Mouse RGMB Protein is widely used in research and clinical applications due to its unique structure, activity, and applications.

Structure of Recombinant Mouse RGMB Protein

Recombinant Mouse RGMB Protein is a glycosylated protein that belongs to the repulsive guidance molecule (RGM) family. It is composed of 346 amino acids and has a molecular weight of approximately 38 kDa. The protein structure consists of a signal peptide, a C-terminal domain, and an N-terminal domain. The N-terminal domain is responsible for binding to its receptor, neogenin, while the C-terminal domain is involved in protein-protein interactions.

The recombinant protein is produced in a mammalian expression system, ensuring proper folding and post-translational modifications. This results in a highly pure and biologically active protein that closely resembles the native protein found in the body.

Activity of Recombinant Mouse RGMB Protein

Recombinant Mouse RGMB Protein has been shown to have diverse biological activities. It is primarily known for its role as a repulsive guidance molecule, which helps in the development and maintenance of the nervous system. This protein is involved in axon guidance, neuronal migration, and synapse formation.

In addition to its role in the nervous system, Recombinant Mouse RGMB Protein also has anti-angiogenic properties. It inhibits the formation of new blood vessels, making it a potential therapeutic target for diseases such as cancer and diabetic retinopathy. Studies have also shown that this protein has anti-inflammatory effects, making it a promising candidate for the treatment of inflammatory diseases.

Applications of Recombinant Mouse RGMB Protein

The unique structure and activity of Recombinant Mouse RGMB Protein make it a valuable tool in various research and clinical applications. Its ability to bind to neogenin and modulate its signaling pathway has made it a popular protein for studying nervous system development and function.

Recombinant Mouse RGMB Protein is also used in drug discovery and development. Its anti-angiogenic and anti-inflammatory properties make it a potential therapeutic target for various diseases. Researchers are currently investigating the use of this protein in the treatment of cancer, diabetic retinopathy, and other inflammatory conditions.

Moreover, Recombinant Mouse RGMB Protein is used in diagnostic assays to detect the presence of neogenin in biological samples. This can help in the diagnosis of diseases related to the nervous system, as well as cancer and inflammatory conditions.

Conclusion

In summary, Recombinant Mouse RGMB Protein is a highly versatile protein with a unique structure and diverse biological activities. Its role in the nervous system, as well as its anti-angiogenic and anti-inflammatory properties, make it a valuable tool in research and a potential therapeutic target for various diseases. The use of this protein in diagnostic assays further highlights its importance in the field of biomedicine. With ongoing research and advancements in recombinant DNA technology, the potential applications of Recombinant Mouse RGMB Protein are vast and promising.

Recombinant Mouse RGMB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse RGMB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products