Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse VSIG2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9Z109
Molecular weight:
24.15 kDa

Original price was: €243.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Glu26–Ser234
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse VSIG2 Protein, N-His

Product name ARO-P10439-100
Uniprot ID Q9Z109
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EVTVPTEPLSVPKGKTAELSCSYKTSVGDNFALEWSFVQPGKPISASVPVLYFTNGHLYPTGSKADRAILLHDPPTGGLATLKLTDLRPSDTGTYLCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVGGSAALGCRSSEGAPKPVYNWERLGSSPTPPPGSMVQDEVSGQLILTNLSLTSSGTYRCVASNQMGSASCELNLS
Molecular weight 24.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Ser234
Aliases /Synonyms V-set and immunoglobulin domain-containing protein 2, CT-like protein, VSIG2, Cortical thymocyte-like protein, CTH, CTXL
Reference ARO-P10439
Note For research use only.
Molecular Constructor
Glu26–Ser234
Product name ARO-P10439-1MG
Uniprot ID Q9Z109
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EVTVPTEPLSVPKGKTAELSCSYKTSVGDNFALEWSFVQPGKPISASVPVLYFTNGHLYPTGSKADRAILLHDPPTGGLATLKLTDLRPSDTGTYLCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVGGSAALGCRSSEGAPKPVYNWERLGSSPTPPPGSMVQDEVSGQLILTNLSLTSSGTYRCVASNQMGSASCELNLS
Molecular weight 24.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Ser234
Aliases /Synonyms V-set and immunoglobulin domain-containing protein 2, CT-like protein, VSIG2, Cortical thymocyte-like protein, CTH, CTXL
Reference ARO-P10439
Note For research use only.
Molecular Constructor
Glu26–Ser234
Product name ARO-P10439-50
Uniprot ID Q9Z109
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EVTVPTEPLSVPKGKTAELSCSYKTSVGDNFALEWSFVQPGKPISASVPVLYFTNGHLYPTGSKADRAILLHDPPTGGLATLKLTDLRPSDTGTYLCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVGGSAALGCRSSEGAPKPVYNWERLGSSPTPPPGSMVQDEVSGQLILTNLSLTSSGTYRCVASNQMGSASCELNLS
Molecular weight 24.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Ser234
Aliases /Synonyms V-set and immunoglobulin domain-containing protein 2, CT-like protein, VSIG2, Cortical thymocyte-like protein, CTH, CTXL
Reference ARO-P10439
Note For research use only.
Molecular Constructor
Glu26–Ser234

Introduction

Recombinant Mouse VSIG2 Protein, also known as V-set and immunoglobulin domain-containing protein 2, is a type I transmembrane protein that is encoded by the VSIG2 gene. This protein belongs to the immunoglobulin superfamily and is expressed in various tissues including the brain, heart, and lungs. Recombinant Mouse VSIG2 Protein is widely used in scientific research for its unique structure and diverse functions.

Structure

Recombinant Mouse VSIG2 Protein is composed of 2 extracellular immunoglobulin domains, a transmembrane domain, and a cytoplasmic tail. The extracellular domains contain a V-set domain and an immunoglobulin-like C2-type domain, both of which are involved in protein-protein interactions. The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic tail is responsible for intracellular signaling.

Activity

Recombinant Mouse VSIG2 Protein is a cell surface protein that plays a role in cell adhesion and immune regulation. It has been shown to interact with various proteins, including integrins and CD24, to mediate cell-cell interactions. Additionally, it has been found to modulate T-cell activation and cytokine production, suggesting its involvement in immune response regulation.

Application

Recombinant Mouse VSIG2 Protein has a wide range of applications in scientific research. Its unique structure and activity make it a valuable tool for studying cell adhesion, immune regulation, and other biological processes. Some specific applications include:

1. Recombinant protein production

Recombinant Mouse VSIG2 Protein can be produced in large quantities using genetic engineering techniques. This allows for the study of its structure and function in a controlled environment, without the need for large amounts of native protein.

2. Antigen for antibody production

Recombinant Mouse VSIG2 Protein can be used as an antigen to produce specific antibodies. These antibodies can then be used to study the expression and localization of the protein in different tissues and cell types.

3. Cell adhesion studies

Recombinant Mouse VSIG2 Protein is known to play a role in cell adhesion, making it a valuable tool for studying this process. Its interactions with other proteins can be investigated using various techniques, such as cell adhesion assays and co-immunoprecipitation.

4. Immune response modulation

Given its involvement in immune regulation, Recombinant Mouse VSIG2 Protein can be used to study the effects of this protein on T-cell activation and cytokine production. This can provide insights into potential therapeutic applications for immune-related diseases.

5. Biomarker discovery

Recombinant Mouse VSIG2 Protein has been found to be differentially expressed in various diseases, including cancer and autoimmune disorders. Therefore, it can be used as a potential biomarker for disease diagnosis and prognosis.

Conclusion

In summary, Recombinant Mouse VSIG2 Protein is a unique and versatile protein that has various applications in scientific research. Its structure, activity, and role in cell adhesion and immune regulation make it a valuable tool for studying various biological processes and diseases. With ongoing research, this protein may also hold potential for therapeutic applications in the future.

Recombinant Mouse VSIG2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse VSIG2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products