Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse GDF15/MIC1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9Z0J7
Molecular weight:
23.47 kDa

Original price was: €255.00.Current price is: €230.00.

50ug 10% OFF + 230 loyalty points
Gly203–Ala303
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse GDF15/MIC1 Protein, N-His-SUMO

Product name ARO-P11108-100
Uniprot ID Q9Z0J7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Molecular weight 23.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly203-Ala303
Aliases /Synonyms Mic1, GDF-15, Sbf, Growth/differentiation factor 15, Macrophage inhibitory cytokine 1, Gdf15, MIC-1
Reference ARO-P11108
Note For research use only.
Molecular Constructor
Gly203–Ala303
Product name ARO-P11108-1MG
Uniprot ID Q9Z0J7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Molecular weight 23.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly203-Ala303
Aliases /Synonyms Mic1, GDF-15, Sbf, Growth/differentiation factor 15, Macrophage inhibitory cytokine 1, Gdf15, MIC-1
Reference ARO-P11108
Note For research use only.
Molecular Constructor
Gly203–Ala303
Product name ARO-P11108-50
Uniprot ID Q9Z0J7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Molecular weight 23.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly203-Ala303
Aliases /Synonyms Mic1, GDF-15, Sbf, Growth/differentiation factor 15, Macrophage inhibitory cytokine 1, Gdf15, MIC-1
Reference ARO-P11108
Note For research use only.
Molecular Constructor
Gly203–Ala303

Introduction to Recombinant Mouse GDF15/MIC1 Protein

Recombinant Mouse GDF15/MIC1 Protein is a type of recombinant protein that has been specifically designed to mimic the naturally occurring protein GDF15, also known as macrophage inhibitory cytokine 1 (MIC1). This protein is produced by recombinant DNA technology, which involves inserting the gene for GDF15 into a host organism, such as bacteria or yeast, and allowing it to produce the protein in large quantities.

Structure of Recombinant Mouse GDF15/MIC1 Protein

Recombinant Mouse GDF15/MIC1 Protein has a similar structure to the naturally occurring GDF15 protein. It is composed of 112 amino acids and has a molecular weight of approximately 12.5 kDa. The protein has a unique tertiary structure, with a central core consisting of four beta strands and a C-terminal alpha helix. This structure is essential for the protein’s function and activity.

Activity of Recombinant Mouse GDF15/MIC1 Protein

Recombinant Mouse GDF15/MIC1 Protein has been shown to have various activities in different biological processes. It is primarily known for its role as a cytokine, which is a type of signaling molecule that regulates the immune system. The protein is produced by various cell types, including macrophages, and has been found to have anti-inflammatory and immunomodulatory effects.

Additionally, Recombinant Mouse GDF15/MIC1 Protein has been shown to play a role in cancer development and progression. It has been found to be overexpressed in various types of cancer, including pancreatic, colorectal, and breast cancer. The protein has been linked to tumor growth, angiogenesis, and metastasis, making it a potential target for cancer treatment.

Application of Recombinant Mouse GDF15/MIC1 Protein

Recombinant Mouse GDF15/MIC1 Protein has various applications in both research and clinical settings. In research, the protein is used to study its role in different biological processes, including inflammation and cancer. It can also be used to develop animal models for studying GDF15-related diseases.

In the clinical setting, Recombinant Mouse GDF15/MIC1 Protein has potential therapeutic applications. Its anti-inflammatory and immunomodulatory effects make it a potential treatment for autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. Additionally, the protein’s role in cancer makes it a potential target for cancer therapy, either as a standalone treatment or in combination with other therapies.

Antigen Detection using Recombinant Mouse GDF15/MIC1 Protein

Recombinant Mouse GDF15/MIC1 Protein can also be used as an antigen in diagnostic tests for various diseases. Antigens are substances that can trigger an immune response and are often used in diagnostic tests to detect the presence of specific antibodies in a person’s blood or other bodily fluids.

By using Recombinant Mouse GDF15/MIC1 Protein as an antigen, scientists and healthcare professionals can detect the presence of antibodies against this protein in a patient’s blood. This can be useful in diagnosing diseases associated with GDF15, such as cancer, and monitoring the progression of the disease.

Conclusion

Recombinant Mouse GDF15/MIC1 Protein is a valuable tool in scientific research and has potential therapeutic applications in the treatment of various diseases. Its unique structure and activity make it a versatile protein that can be used in different biological processes. By understanding the structure, activity, and applications of this protein, scientists can continue to unlock its potential in both research and clinical settings.

Recombinant Mouse GDF15/MIC1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse GDF15/MIC1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products