Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ELANE/Neutrophil elastase Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q3UP87
Molecular weight:
25 kDa

Original price was: €255.00.Current price is: €230.00.

50ug 10% OFF + 230 loyalty points
Phe42–Glu237
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ELANE/Neutrophil elastase Protein, N-His

Product name ARO-P10921-100
Uniprot ID Q3UP87
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence FMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAE
Molecular weight 25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe42-Glu237
Aliases /Synonyms Neutrophil elastase, 3.4.21.37, Elastase-2, Leukocyte elastase, Elane, Ela2
Reference ARO-P10921
Note For research use only.
Molecular Constructor
Phe42–Glu237
Product name ARO-P10921-1MG
Uniprot ID Q3UP87
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence FMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAE
Molecular weight 25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe42-Glu237
Aliases /Synonyms Neutrophil elastase, 3.4.21.37, Elastase-2, Leukocyte elastase, Elane, Ela2
Reference ARO-P10921
Note For research use only.
Molecular Constructor
Phe42–Glu237
Product name ARO-P10921-50
Uniprot ID Q3UP87
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence FMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAE
Molecular weight 25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe42-Glu237
Aliases /Synonyms Neutrophil elastase, 3.4.21.37, Elastase-2, Leukocyte elastase, Elane, Ela2
Reference ARO-P10921
Note For research use only.
Molecular Constructor
Phe42–Glu237

Introduction

Recombinant Mouse ELANE/Neutrophil elastase protein is a highly purified and biologically active protein that is widely used in research and diagnostic applications. This protein is a member of the serine protease family and is primarily expressed in neutrophils, where it plays a crucial role in the innate immune response. In this article, we will discuss the structure, activity, and applications of this important recombinant protein.

Structure of Recombinant Mouse ELANE/Neutrophil elastase Protein

The recombinant Mouse ELANE/Neutrophil elastase protein is a 30 kDa protein consisting of 267 amino acids. It is composed of a catalytic domain, a propeptide region, and a C-terminal domain. The catalytic domain is responsible for the proteolytic activity of the protein, while the propeptide region is involved in the regulation of its activity. The C-terminal domain is important for the binding of the protein to its substrates.

The recombinant protein is produced through genetic engineering techniques, where the gene for ELANE is inserted into a suitable expression vector and then expressed in a host cell, such as E. coli. This allows for the production of large quantities of pure and highly active protein.

Activity of Recombinant Mouse ELANE/Neutrophil elastase Protein

Recombinant Mouse ELANE/Neutrophil elastase protein is a potent serine protease that is involved in the degradation of extracellular matrix proteins, such as elastin, collagen, and fibronectin. It is also capable of degrading a variety of other proteins, including cytokines, chemokines, and complement proteins. This proteolytic activity is crucial for the proper functioning of the immune system, as it helps in the clearance of pathogens and damaged tissues.

The activity of the recombinant protein can be measured using various assays, such as chromogenic, fluorogenic, and ELISA-based assays. These assays utilize specific substrates that are cleaved by ELANE, resulting in a color or fluorescence signal that can be quantified. This allows for the accurate measurement of the enzyme activity in different samples.

Applications of Recombinant Mouse ELANE/Neutrophil elastase Protein

Recombinant Mouse ELANE/Neutrophil elastase protein has a wide range of applications in research and diagnostics. One of its primary uses is in the study of the immune response and inflammation. The recombinant protein can be used to induce inflammation in animal models, allowing for the investigation of the role of ELANE in various disease conditions.

Furthermore, the recombinant protein is also used in the development of diagnostic tests for various diseases. For example, it is used as an antigen in ELISA-based tests for the detection of autoimmune disorders, such as Wegener’s granulomatosis and anti-neutrophil cytoplasmic antibody (ANCA)-associated vasculitis. Its ability to degrade extracellular matrix proteins also makes it a valuable tool in wound healing studies.

In addition, recombinant Mouse ELANE/Neutrophil elastase protein is also used in the production of monoclonal antibodies. The protein can be used as an immunogen to generate specific antibodies that can be used for various research and diagnostic purposes.

Conclusion

Recombinant Mouse ELANE/Neutrophil elastase protein is a highly purified and biologically active protein that plays a crucial role in the innate immune response. Its structure, activity, and applications make it a valuable tool in various research and diagnostic fields. With the advancement of genetic engineering techniques, the production of this important protein has become more efficient and cost-effective, allowing for its widespread use in the scientific community.

Recombinant Mouse ELANE/Neutrophil elastase Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ELANE/Neutrophil elastase Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products