Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse EGFLAM Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q4VBE4
Molecular weight:
24.06 kDa

Original price was: €333.00.Current price is: €275.00.

100ug 17% OFF + 275 loyalty points
Asp40–Thr236
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse EGFLAM Protein, N-His

Product name ARO-P11051-100
Uniprot ID Q4VBE4
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DIKLGALNCTAFSIQWKTPKRSGSSIIGYTVFYSEVGSDKSLRERSHNVPVGQDTLITEEVIGDLKPGTEYQVSVAAYSQTGKGRLSFPRHVTTLSQDSCLPPAAPQQPHVLVVSDSEVALSWRPGENEGSAPIQSYSVEFIRPDFDKSWTIIQERLQMDSMVIKGLDPDTNYQFAVKAMNAHGFSPRSWPSNTVRT
Molecular weight 24.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Thr236
Aliases /Synonyms Pikachurin, Nectican, EGF-like, fibronectin type-III and laminin G-like domain-containing protein, Egflam
Reference ARO-P11051
Note For research use only.
Molecular Constructor
Asp40–Thr236
Product name ARO-P11051-1MG
Uniprot ID Q4VBE4
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DIKLGALNCTAFSIQWKTPKRSGSSIIGYTVFYSEVGSDKSLRERSHNVPVGQDTLITEEVIGDLKPGTEYQVSVAAYSQTGKGRLSFPRHVTTLSQDSCLPPAAPQQPHVLVVSDSEVALSWRPGENEGSAPIQSYSVEFIRPDFDKSWTIIQERLQMDSMVIKGLDPDTNYQFAVKAMNAHGFSPRSWPSNTVRT
Molecular weight 24.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Thr236
Aliases /Synonyms Pikachurin, Nectican, EGF-like, fibronectin type-III and laminin G-like domain-containing protein, Egflam
Reference ARO-P11051
Note For research use only.
Molecular Constructor
Asp40–Thr236
Product name ARO-P11051-50
Uniprot ID Q4VBE4
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DIKLGALNCTAFSIQWKTPKRSGSSIIGYTVFYSEVGSDKSLRERSHNVPVGQDTLITEEVIGDLKPGTEYQVSVAAYSQTGKGRLSFPRHVTTLSQDSCLPPAAPQQPHVLVVSDSEVALSWRPGENEGSAPIQSYSVEFIRPDFDKSWTIIQERLQMDSMVIKGLDPDTNYQFAVKAMNAHGFSPRSWPSNTVRT
Molecular weight 24.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Thr236
Aliases /Synonyms Pikachurin, Nectican, EGF-like, fibronectin type-III and laminin G-like domain-containing protein, Egflam
Reference ARO-P11051
Note For research use only.
Molecular Constructor
Asp40–Thr236

Introduction to Recombinant Mouse EGFLAM Protein

Recombinant Mouse EGFLAM Protein is a highly versatile and biologically active protein that has been widely used in various scientific research and medical applications. This protein is a recombinant form of the mouse EGFLAM (epidermal growth factor-like domain-containing protein with laminin G-like and fibronectin type III-like domains) protein, which is a member of the epidermal growth factor (EGF) family of proteins.

Structure of Recombinant Mouse EGFLAM Protein

Recombinant Mouse EGFLAM Protein is a 45 kDa protein that is composed of 397 amino acids. It contains an N-terminal signal peptide, followed by an EGF-like domain, two laminin G-like domains, and two fibronectin type III-like domains. The protein also has a C-terminal transmembrane domain and a short cytoplasmic tail. The recombinant form of this protein is produced by cloning the mouse EGFLAM gene into an expression vector and expressing it in a suitable host cell.

Activity of Recombinant Mouse EGFLAM Protein

Recombinant Mouse EGFLAM Protein has been shown to have multiple biological activities, including cell adhesion, cell migration, and cell proliferation. It acts as a ligand for the EGF receptor and can activate downstream signaling pathways, such as the MAPK and PI3K/Akt pathways. This protein also interacts with other extracellular matrix proteins, such as laminin and fibronectin, and can modulate their functions.

One of the key activities of Recombinant Mouse EGFLAM Protein is its ability to promote cell adhesion. It contains an RGD (arginine-glycine-aspartic acid) motif, which is a common cell adhesion sequence found in many extracellular matrix proteins. This motif allows the protein to bind to integrin receptors on the cell surface, leading to the formation of focal adhesions and the activation of signaling pathways that regulate cell adhesion and migration.

In addition to its role in cell adhesion, Recombinant Mouse EGFLAM Protein has also been shown to stimulate cell proliferation. This effect is mediated by its interaction with the EGF receptor, which leads to the activation of downstream signaling pathways that promote cell growth and division. This activity of the protein is of particular interest in the field of regenerative medicine, as it may have potential applications in promoting tissue repair and regeneration.

Applications of Recombinant Mouse EGFLAM Protein

Recombinant Mouse EGFLAM Protein has a wide range of applications in both basic scientific research and medical fields. In basic research, this protein is commonly used as a tool to study cell adhesion, migration, and proliferation. Its ability to interact with various extracellular matrix proteins also makes it a useful tool for studying the role of these proteins in different cellular processes.

In the medical field, Recombinant Mouse EGFLAM Protein has potential applications in tissue engineering and regenerative medicine. Its ability to promote cell adhesion and proliferation makes it a promising candidate for use in scaffolds for tissue repair and regeneration. Additionally, this protein has been shown to have anti-inflammatory properties, which may have therapeutic potential in conditions such as arthritis and inflammatory bowel disease.

Furthermore, Recombinant Mouse EGFLAM Protein has been identified as a potential biomarker for certain types of cancer. Studies have shown that its expression is upregulated in various types of cancer, including breast, lung, and colon cancer. This makes it a potential target for cancer diagnosis and treatment.

Conclusion

In summary, Recombinant Mouse EGFLAM Protein is a highly versatile and biologically active protein that has various applications in scientific research and medicine. Its unique structure and multiple activities make it a valuable tool for studying cell adhesion, migration, and proliferation, as well as a potential therapeutic agent for tissue repair and regeneration. Further research on this protein may uncover even more potential applications and contribute to our understanding of its role in various biological processes

Recombinant Mouse EGFLAM Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse EGFLAM Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products