Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD354/TREM1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9JKE2
Molecular weight:
14.99 kDa

Original price was: €358.00.Current price is: €275.00.

100ug 23% OFF + 275 loyalty points
Glu26–Lys135
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD354/TREM1 Protein, N-His

Product name ARO-P10459-100
Uniprot ID Q9JKE2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTK
Molecular weight 14.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Lys135
Aliases /Synonyms TREM1, Triggering receptor expressed on monocytes 1, Triggering receptor expressed on myeloid cells 1, TREM-1, CD354
Reference ARO-P10459
Note For research use only.
Molecular Constructor
Glu26–Lys135
Product name ARO-P10459-1MG
Uniprot ID Q9JKE2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTK
Molecular weight 14.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Lys135
Aliases /Synonyms TREM1, Triggering receptor expressed on monocytes 1, Triggering receptor expressed on myeloid cells 1, TREM-1, CD354
Reference ARO-P10459
Note For research use only.
Molecular Constructor
Glu26–Lys135
Product name ARO-P10459-50
Uniprot ID Q9JKE2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTK
Molecular weight 14.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Lys135
Aliases /Synonyms TREM1, Triggering receptor expressed on monocytes 1, Triggering receptor expressed on myeloid cells 1, TREM-1, CD354
Reference ARO-P10459
Note For research use only.
Molecular Constructor
Glu26–Lys135

Introduction

Recombinant Mouse CD354/TREM1 Protein, also known as Triggering Receptor Expressed on Myeloid Cells 1, is a type I transmembrane protein that belongs to the immunoglobulin superfamily. It is encoded by the TREM1 gene and is primarily expressed on myeloid cells, including monocytes, macrophages, and neutrophils. This protein has been extensively studied for its role in regulating the immune response and its potential as a therapeutic target for various inflammatory diseases.

Structure

The Recombinant Mouse CD354/TREM1 Protein is a 227 amino acid long protein with a predicted molecular weight of approximately 25 kDa. It consists of a single extracellular immunoglobulin-like domain, a transmembrane region, and a short cytoplasmic tail. The extracellular domain contains a conserved charged residue that is critical for its binding to its ligand, and the cytoplasmic tail contains a conserved tyrosine residue that is important for signaling.

Activity

Recombinant Mouse CD354/TREM1 Protein is a potent amplifier of the inflammatory response. It is activated upon binding to its ligand, which can be either bacterial or host-derived. This binding triggers a signaling cascade that leads to the production of pro-inflammatory cytokines, such as TNF-α, IL-1β, and IL-6, as well as chemokines, such as IL-8. These molecules play a crucial role in recruiting and activating immune cells to the site of infection or tissue damage.

In addition to its role in inflammation, Recombinant Mouse CD354/TREM1 Protein has also been shown to have a role in sepsis and septic shock. Studies have demonstrated that TREM1 is upregulated in patients with sepsis and that its blockade can improve survival in animal models of sepsis. This further highlights the importance of this protein in regulating the immune response and its potential as a therapeutic target.

Application

Recombinant Mouse CD354/TREM1 Protein has various applications in both research and clinical settings. It is commonly used in in vitro studies to investigate the role of TREM1 in different disease states, such as sepsis, inflammatory bowel disease, and rheumatoid arthritis. It is also used in preclinical studies to evaluate the efficacy of TREM1-targeted therapeutics.

In addition, Recombinant Mouse CD354/TREM1 Protein has potential clinical applications as a biomarker and therapeutic target. Its expression levels have been correlated with disease severity in various inflammatory conditions, making it a potential biomarker for disease diagnosis and prognosis. Furthermore, several TREM1-targeted therapies are currently being developed for the treatment of sepsis and other inflammatory diseases, highlighting the potential of this protein as a therapeutic target.

Conclusion

In conclusion, Recombinant Mouse CD354/TREM1 Protein is a key player in regulating the immune response and has potential applications in both research and clinical settings. Its structure, activity, and potential applications make it a promising target for the development of novel therapeutics for various inflammatory diseases. Further research on this protein is essential for a better understanding of its role in disease pathogenesis and for the development of effective treatments.

Recombinant Mouse CD354/TREM1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD354/TREM1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products