Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ACE2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8R0I0
Molecular weight:
13.84 kDa

Original price was: €281.00.Current price is: €230.00.

50ug 18% OFF + 230 loyalty points
Ser617–Gly716
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ACE2 Protein, N-His

Product name ARO-P10488-100
Uniprot ID Q8R0I0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIKVRISLKSALGANAYEWTNNEMFLFRSSVAYAMRKYFSIIKNQTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIPRSEVEDAIRMSRGRINDVFG
Molecular weight 13.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser617-Gly716
Aliases /Synonyms Angiotensin-converting enzyme homolog, ACE2, ACEH, Metalloprotease MPROT15, Angiotensin-converting enzyme-related carboxypeptidase, Angiotensin-converting enzyme 2, ACE-related carboxypeptidase
Reference ARO-P10488
Note For research use only.
Molecular Constructor
Ser617–Gly716
Product name ARO-P10488-1MG
Uniprot ID Q8R0I0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIKVRISLKSALGANAYEWTNNEMFLFRSSVAYAMRKYFSIIKNQTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIPRSEVEDAIRMSRGRINDVFG
Molecular weight 13.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser617-Gly716
Aliases /Synonyms Angiotensin-converting enzyme homolog, ACE2, ACEH, Metalloprotease MPROT15, Angiotensin-converting enzyme-related carboxypeptidase, Angiotensin-converting enzyme 2, ACE-related carboxypeptidase
Reference ARO-P10488
Note For research use only.
Molecular Constructor
Ser617–Gly716
Product name ARO-P10488-50
Uniprot ID Q8R0I0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIKVRISLKSALGANAYEWTNNEMFLFRSSVAYAMRKYFSIIKNQTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIPRSEVEDAIRMSRGRINDVFG
Molecular weight 13.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser617-Gly716
Aliases /Synonyms Angiotensin-converting enzyme homolog, ACE2, ACEH, Metalloprotease MPROT15, Angiotensin-converting enzyme-related carboxypeptidase, Angiotensin-converting enzyme 2, ACE-related carboxypeptidase
Reference ARO-P10488
Note For research use only.
Molecular Constructor
Ser617–Gly716

Introduction to Recombinant Mouse ACE2 Protein

Recombinant Mouse ACE2 Protein, also known as angiotensin-converting enzyme 2, is a type I transmembrane glycoprotein that plays a crucial role in the renin-angiotensin system (RAS). It is a key component of the cardiovascular and immune systems, and has been extensively studied for its role in various diseases, including cardiovascular diseases and viral infections.

Structure of Recombinant Mouse ACE2 Protein

Recombinant Mouse ACE2 Protein is a 805-amino acid protein with a molecular weight of approximately 90 kDa. It consists of a large extracellular domain, a single transmembrane domain, and a short cytoplasmic tail. The extracellular domain contains the active site of the enzyme, which is a zinc-dependent metalloprotease domain. This domain is responsible for the cleavage of angiotensin II, a vasoconstrictor, into angiotensin 1-7, a vasodilator.

Activity of Recombinant Mouse ACE2 Protein

The main function of Recombinant Mouse ACE2 Protein is to regulate the RAS by converting angiotensin II to angiotensin 1-7. This process helps to maintain blood pressure and fluid balance in the body. In addition, Recombinant Mouse ACE2 Protein also has a protective role in the cardiovascular system by inhibiting the production of reactive oxygen species and reducing inflammation.

Aside from its role in the RAS, Recombinant Mouse ACE2 Protein has also been found to have a crucial role in viral infections. It serves as the cellular receptor for the severe acute respiratory syndrome coronavirus (SARS-CoV) and the newly emerged SARS-CoV-2, which causes COVID-19. The binding of the virus to Recombinant Mouse ACE2 Protein allows for viral entry and infection of host cells.

Application of Recombinant Mouse ACE2 Protein

Recombinant Mouse ACE2 Protein has various applications in both research and therapeutic fields. In research, it is used as a tool to study the role of RAS in different diseases, such as hypertension and heart failure. It is also utilized in the study of viral infections, particularly in understanding the mechanism of viral entry and developing potential treatments.

In the therapeutic field, Recombinant Mouse ACE2 Protein has shown promising results in the treatment of cardiovascular diseases. Its ability to regulate the RAS and reduce inflammation makes it a potential target for the treatment of hypertension, heart failure, and other cardiovascular conditions. In addition, there are ongoing studies on the use of Recombinant Mouse ACE2 Protein as a potential treatment for COVID-19, as it has been shown to block viral entry and reduce lung injury in animal models.

Conclusion

In summary, Recombinant Mouse ACE2 Protein is a crucial protein with important roles in both the cardiovascular and immune systems. Its structure, activity, and application have been extensively studied, and it has shown potential as a therapeutic target for various diseases, including cardiovascular diseases and viral infections. Further research and development of Recombinant Mouse ACE2 Protein could lead to new treatments and improve our understanding of these complex diseases.

Recombinant Mouse ACE2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ACE2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products