Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD204/MSR1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P30204
Molecular weight:
13.61 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Thr356–Ser458
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD204/MSR1 Protein, N-His

Product name ARO-P11022-100
Uniprot ID P30204
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Molecular weight 13.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr356-Ser458
Aliases /Synonyms CD204, Macrophage acetylated LDL receptor I and II, Scvr, Scavenger receptor type A, Msr1, Macrophage scavenger receptor types I and II, SR-A
Reference ARO-P11022
Note For research use only.
Molecular Constructor
Thr356–Ser458
Product name ARO-P11022-1MG
Uniprot ID P30204
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Molecular weight 13.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr356-Ser458
Aliases /Synonyms CD204, Macrophage acetylated LDL receptor I and II, Scvr, Scavenger receptor type A, Msr1, Macrophage scavenger receptor types I and II, SR-A
Reference ARO-P11022
Note For research use only.
Molecular Constructor
Thr356–Ser458
Product name ARO-P11022-50
Uniprot ID P30204
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Molecular weight 13.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr356-Ser458
Aliases /Synonyms CD204, Macrophage acetylated LDL receptor I and II, Scvr, Scavenger receptor type A, Msr1, Macrophage scavenger receptor types I and II, SR-A
Reference ARO-P11022
Note For research use only.
Molecular Constructor
Thr356–Ser458

Introduction

Recombinant Mouse CD204/MSR1 Protein, also known as Macrophage Scavenger Receptor 1, is a protein that plays a crucial role in the immune system. It is a type I transmembrane protein that is expressed on the surface of macrophages, dendritic cells, and some endothelial cells. This protein is encoded by the MSR1 gene and is highly conserved among mammals. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse CD204/MSR1 Protein.

Structure of Recombinant Mouse CD204/MSR1 Protein

Recombinant Mouse CD204/MSR1 Protein is a 175 kDa protein that consists of 1261 amino acids. It is composed of three domains: an N-terminal cytoplasmic domain, a transmembrane domain, and a C-terminal extracellular domain. The extracellular domain contains a cysteine-rich domain, a collagen-like domain, and a scavenger receptor cysteine-rich (SRCR) domain. The SRCR domain is responsible for the binding of various ligands, including modified lipoproteins, bacteria, and apoptotic cells.

Activity of Recombinant Mouse CD204/MSR1 Protein

Recombinant Mouse CD204/MSR1 Protein is a multifunctional protein that plays a crucial role in the innate immune response. It acts as a pattern recognition receptor (PRR) and recognizes a wide range of ligands, including lipoproteins, bacteria, and apoptotic cells. Upon ligand binding, CD204/MSR1 triggers a signaling cascade that leads to the activation of various immune responses, such as phagocytosis, antigen presentation, and cytokine production.

One of the main functions of Recombinant Mouse CD204/MSR1 Protein is the clearance of modified lipoproteins, such as oxidized low-density lipoprotein (oxLDL), from the circulation. This is important in preventing the development of atherosclerosis, a chronic inflammatory disease of the arteries. CD204/MSR1 also plays a role in the clearance of apoptotic cells, which is essential for maintaining tissue homeostasis and preventing autoimmune diseases.

Applications of Recombinant Mouse CD204/MSR1 Protein

Due to its diverse functions, Recombinant Mouse CD204/MSR1 Protein has various applications in both research and clinical settings. One of its main applications is in the study of atherosclerosis. CD204/MSR1-deficient mice have been shown to develop more severe atherosclerotic lesions, highlighting the importance of this protein in the prevention of this disease. Recombinant Mouse CD204/MSR1 Protein can also be used as a biomarker for atherosclerosis, as its expression is upregulated in atherosclerotic plaques.

In addition to atherosclerosis, CD204/MSR1 has been implicated in other diseases, such as Alzheimer’s disease and cancer. In Alzheimer’s disease, CD204/MSR1 is involved in the clearance of amyloid-beta plaques, which are a hallmark of this neurodegenerative disorder. In cancer, CD204/MSR1 has been shown to play a role in tumor growth and metastasis. Therefore, Recombinant Mouse CD204/MSR1 Protein can be used in the study of these diseases and as a potential therapeutic target.

Furthermore, Recombinant Mouse CD204/MSR1 Protein has potential applications in immunotherapy. As a scavenger receptor, CD204/MSR1 is involved in the uptake and presentation of antigens to immune cells. This makes it a potential target for antigen delivery in cancer immunotherapy. Recombinant Mouse CD204/MSR1 Protein can also be used as an adjuvant in vaccines, as it can enhance the immune response to antigens.

Conclusion

Recombinant Mouse CD204/MSR1 Protein is a vital protein

Recombinant Mouse CD204/MSR1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD204/MSR1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products