Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD134/TNFRSF4/OX40 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P47741
Molecular weight:
18.56 kDa

Original price was: €274.00.Current price is: €230.00.

50ug 16% OFF + 230 loyalty points
Thr31–Thr177
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD134/TNFRSF4/OX40 Protein, N-His

Product name ARO-P10581-100
Uniprot ID P47741
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWET
Molecular weight 18.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Thr177
Aliases /Synonyms ACT35 antigen, TXGP1L, TAX transcriptionally-activated glycoprotein 1 receptor, Tumor necrosis factor receptor superfamily member 4, TNFRSF4, OX40L receptor, CD134
Reference ARO-P10581
Note For research use only.
Molecular Constructor
Thr31–Thr177
Product name ARO-P10581-1MG
Uniprot ID P47741
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWET
Molecular weight 18.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Thr177
Aliases /Synonyms ACT35 antigen, TXGP1L, TAX transcriptionally-activated glycoprotein 1 receptor, Tumor necrosis factor receptor superfamily member 4, TNFRSF4, OX40L receptor, CD134
Reference ARO-P10581
Note For research use only.
Molecular Constructor
Thr31–Thr177
Product name ARO-P10581-50
Uniprot ID P47741
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWET
Molecular weight 18.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Thr177
Aliases /Synonyms ACT35 antigen, TXGP1L, TAX transcriptionally-activated glycoprotein 1 receptor, Tumor necrosis factor receptor superfamily member 4, TNFRSF4, OX40L receptor, CD134
Reference ARO-P10581
Note For research use only.
Molecular Constructor
Thr31–Thr177

Introduction

Recombinant proteins have revolutionized the field of biotechnology by providing a means to produce large quantities of specific proteins for research and therapeutic purposes. One such protein is Recombinant Mouse CD134/TNFRSF4/OX40, which plays a crucial role in immune regulation and has potential applications in cancer therapy and autoimmune diseases. In this article, we will delve into the structure, activity, and applications of this important protein.

Structure of Recombinant Mouse CD134/TNFRSF4/OX40 Protein

The Recombinant Mouse CD134/TNFRSF4/OX40 protein, also known as OX40, is a member of the tumor necrosis factor receptor superfamily. It is a type I transmembrane protein with a molecular weight of approximately 50 kDa. The protein is composed of four domains: an extracellular domain, a transmembrane domain, and two intracellular domains. The extracellular domain contains four cysteine-rich repeats, which are essential for ligand binding. The intracellular domains contain a death domain and a TNFR-associated factor (TRAF) binding domain, which are involved in signal transduction.

Activity of Recombinant Mouse CD134/TNFRSF4/OX40 Protein

OX40 is primarily expressed on the surface of activated T cells and plays a crucial role in T cell activation and survival. When OX40 binds to its ligand, OX40L, it triggers a signaling cascade that leads to the activation of NF-κB and other downstream signaling molecules. This results in the production of cytokines, such as IL-2, which promote T cell proliferation and survival. OX40 signaling also enhances the differentiation of T cells into effector cells, making it an important regulator of immune responses.

In addition to its role in T cell activation, OX40 has been shown to have a significant impact on the function of other immune cells, such as B cells, dendritic cells, and natural killer cells. It has been reported that OX40 signaling can enhance the production of antibodies by B cells and promote the maturation and activation of dendritic cells. OX40 also plays a role in the regulation of natural killer cell activity, making it a key player in the coordination of immune responses.

Applications of Recombinant Mouse CD134/TNFRSF4/OX40 Protein

The unique structure and activity of OX40 make it a promising target for therapeutic interventions in various diseases. One potential application of Recombinant Mouse CD134/TNFRSF4/OX40 protein is in cancer therapy. OX40 has been shown to enhance the anti-tumor activity of T cells, making it a potential target for immunotherapy. In fact, preclinical studies have demonstrated that OX40 agonists can improve the efficacy of cancer vaccines and checkpoint inhibitors, leading to enhanced anti-tumor responses.

Another potential application of OX40 is in the treatment of autoimmune diseases. OX40 signaling has been shown to play a role in the development and maintenance of autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis. Therefore, targeting OX40 with recombinant protein or agonists could potentially modulate the immune response and provide a novel therapeutic approach for these diseases.

Conclusion

In summary, Recombinant Mouse CD134/TNFRSF4/OX40 protein is a crucial player in immune regulation, with potential applications in cancer therapy and autoimmune diseases. Its unique structure and activity make it an attractive target for therapeutic interventions, and ongoing research continues to uncover its potential in various disease contexts. With the development of recombinant protein technology, we can expect to see further advancements in the use of OX40 as a therapeutic target in

Recombinant Mouse CD134/TNFRSF4/OX40 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD134/TNFRSF4/OX40 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products