Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CCN3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q64299
Molecular weight:
22.00 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Ser50–Arg137
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CCN3 Protein, N-His-SUMO

Product name ARO-P11067-100
Uniprot ID Q64299
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPR
Molecular weight 22.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Arg137
Aliases /Synonyms NovH, Cellular communication network factor 3, CCN family member 3, Nephroblastoma-overexpressed gene protein homolog, Protein NOV homolog, Nov, Ccn3
Reference ARO-P11067
Note For research use only.
Molecular Constructor
Ser50–Arg137
Product name ARO-P11067-1MG
Uniprot ID Q64299
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPR
Molecular weight 22.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Arg137
Aliases /Synonyms NovH, Cellular communication network factor 3, CCN family member 3, Nephroblastoma-overexpressed gene protein homolog, Protein NOV homolog, Nov, Ccn3
Reference ARO-P11067
Note For research use only.
Molecular Constructor
Ser50–Arg137
Product name ARO-P11067-50
Uniprot ID Q64299
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPR
Molecular weight 22.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Arg137
Aliases /Synonyms NovH, Cellular communication network factor 3, CCN family member 3, Nephroblastoma-overexpressed gene protein homolog, Protein NOV homolog, Nov, Ccn3
Reference ARO-P11067
Note For research use only.
Molecular Constructor
Ser50–Arg137

Structure of Recombinant Mouse CCN3 Protein

Recombinant Mouse CCN3 Protein, also known as CCN3 or NOV, is a member of the CCN family of proteins. CCN stands for cysteine-rich protein, which is characterized by a modular structure containing four distinct domains: insulin-like growth factor binding protein (IGFBP), von Willebrand factor type C (VWC), thrombospondin type 1 (TSP1), and a C-terminal cysteine knot (CT). The CCN3 protein is composed of 357 amino acids and has a molecular weight of approximately 40 kDa.

The IGFBP domain of CCN3 is responsible for binding to insulin-like growth factors (IGFs) and modulating their activity. The VWC domain is involved in cell adhesion and the TSP1 domain is known to interact with various extracellular matrix proteins. The C-terminal CT domain is highly conserved among CCN family members and is responsible for the dimerization and multimerization of CCN proteins.

Activity of Recombinant Mouse CCN3 Protein

Recombinant Mouse CCN3 Protein is a secreted protein that plays a crucial role in various cellular processes, including cell proliferation, differentiation, adhesion, migration, and survival. It has been shown to regulate the activity of several signaling pathways, including the Wnt, TGF-β, and Notch pathways.

One of the key activities of CCN3 is its ability to bind to and modulate the activity of IGFs. CCN3 has been shown to enhance the binding of IGFs to their receptors, leading to increased cell proliferation and survival. Additionally, CCN3 can also inhibit the activity of IGFs by sequestering them in the extracellular matrix, thereby preventing their interaction with their receptors.

CCN3 also plays a role in cell adhesion and migration by interacting with various extracellular matrix proteins, such as fibronectin and collagen. This interaction promotes the adhesion and migration of cells, which is essential for processes like wound healing and tissue repair.

Furthermore, CCN3 has been shown to regulate the activity of the Wnt signaling pathway, which is involved in cell proliferation and differentiation. CCN3 can inhibit the activity of Wnt signaling, leading to decreased cell proliferation and increased differentiation.

Application of Recombinant Mouse CCN3 Protein

Recombinant Mouse CCN3 Protein has a wide range of applications in both basic research and clinical settings. Due to its role in various cellular processes, CCN3 has been studied extensively in different disease models.

One of the main applications of CCN3 is in cancer research. It has been shown to play a role in the development and progression of various types of cancer, including breast, lung, and prostate cancer. CCN3 has been found to promote tumor growth and metastasis by enhancing cell proliferation, migration, and survival. Therefore, targeting CCN3 may have therapeutic potential in cancer treatment.

In addition to cancer, CCN3 has also been implicated in other diseases such as fibrosis, cardiovascular diseases, and neurological disorders. It has been shown to play a role in the development of fibrosis by promoting the production of extracellular matrix proteins. In cardiovascular diseases, CCN3 has been found to regulate the activity of smooth muscle cells, which are involved in the development of atherosclerosis. In neurological disorders, CCN3 has been shown to regulate the differentiation and survival of neurons.

Recombinant Mouse CCN3 Protein is also used in basic research to study its role in various cellular processes and signaling pathways. It can be used to investigate the mechanisms underlying its activities and its interactions with other proteins.

In conclusion, Recombinant Mouse CCN3 Protein is a multifunctional protein with diverse activities and applications. Its structure and function make it a crucial player in various cellular processes and its dysregulation has been linked to several diseases. Further research on CCN3 may lead to the development of novel therapeutic interventions for various diseases.

Recombinant Mouse CCN3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse CCN3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products