Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Monkeypox virus/MPXV F3L Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Monkeypox virus (strain Zaire-96-I-16) (MPX)
Uniprot ID:
Q8V528
Molecular weight:
18.61 kDa

302.00

100ug + 302 loyalty points
His Met1–Phe153
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Monkeypox virus/MPXV F3L Protein

Product name Recombinant Monkeypox virus/MPXV F3L Protein
Uniprot ID Q8V528
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Prokaryotic expression
Raw Antigen Sequence MEKREVNKALYDLQRSTMVYSSDDTPPRWSTTMDADTRPTDSDADAIIDDVSREKSMREDNKSFDDVIPVKKIIYWKGVNPVTVINEYCQITRRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLSYVIIRF
Molecular weight 18.61 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe153
Aliases /Synonyms F3L, Monkeypox virus (MPXV), clade 2
Reference PX-P6061
Note For research use only.
Molecular Constructor
His Met1–Phe153

SDS-PAGE for Recombinant Monkeypox virus/MPXV F3L Protein

SDS-PAGE for Recombinant Monkeypox virus/MPXV F3L Protein

Recombinant Monkeypox virus/MPXV F3L Protein, on SDS-PAGE under reducing

Recombinant Monkeypox virus/MPXV F3L Protein

There are no reviews yet.

Be the first to review “Recombinant Monkeypox virus/MPXV F3L Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products