Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human WBP2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q969T9
Molecular weight:
17.04 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points
Met1–Gly136
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human WBP2 Protein, N-His

Product name ARO-P12121-100
Uniprot ID Q969T9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRG
Molecular weight 17.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly136
Aliases /Synonyms WBP-2, WW domain-binding protein 2, WBP2
Reference ARO-P12121
Note For research use only.
Molecular Constructor
Met1–Gly136
Product name ARO-P12121-1MG
Uniprot ID Q969T9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRG
Molecular weight 17.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly136
Aliases /Synonyms WBP-2, WW domain-binding protein 2, WBP2
Reference ARO-P12121
Note For research use only.
Molecular Constructor
Met1–Gly136
Product name ARO-P12121-50
Uniprot ID Q969T9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRG
Molecular weight 17.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly136
Aliases /Synonyms WBP-2, WW domain-binding protein 2, WBP2
Reference ARO-P12121
Note For research use only.
Molecular Constructor
Met1–Gly136

Introduction to Recombinant Human WBP2 Protein

Recombinant Human WBP2 Protein is a genetically engineered protein that has been produced in a laboratory setting using recombinant DNA technology. This protein is a member of the WW domain-binding protein (WBP) family and plays an important role in various cellular processes. In this article, we will explore the structure, activity, and applications of Recombinant Human WBP2 Protein.

Structure of Recombinant Human WBP2 Protein

Recombinant Human WBP2 Protein is a 57 kDa protein that is composed of 505 amino acids. It contains two WW domains, which are small protein modules that are characterized by two conserved tryptophan residues and are involved in protein-protein interactions. The first WW domain of WBP2 is responsible for binding to proline-rich motifs, while the second WW domain binds to phosphorylated serine/threonine residues. This unique structural feature of WBP2 allows it to interact with a wide range of proteins and participate in various cellular processes.

Activity of Recombinant Human WBP2 Protein

Recombinant Human WBP2 Protein is primarily involved in regulating transcription and signaling pathways. It has been shown to interact with various transcription factors, such as p53, c-Jun, and E2F1, and modulate their activity. WBP2 has also been found to interact with components of the Wnt signaling pathway, which plays a crucial role in cell proliferation, differentiation, and development. By interacting with these proteins, WBP2 can influence the expression of genes involved in these processes.

Moreover, WBP2 has been reported to play a role in DNA damage response and repair. It has been shown to interact with the tumor suppressor protein BRCA1, which is involved in repairing DNA damage. This interaction suggests that WBP2 may play a role in maintaining genome stability and preventing the development of cancer.

Applications of Recombinant Human WBP2 Protein

The unique structure and activity of Recombinant Human WBP2 Protein make it a valuable tool for various research applications. One of the major applications of this protein is in studying protein-protein interactions. WBP2 has been shown to interact with a wide range of proteins, and recombinant WBP2 can be used to study these interactions in a controlled environment. This can help researchers understand the role of WBP2 in different cellular processes and identify potential therapeutic targets.

Additionally, Recombinant Human WBP2 Protein can also be used in drug discovery and development. As WBP2 is involved in regulating transcription and signaling pathways, it can be targeted for the development of novel drugs for various diseases, including cancer. Recombinant WBP2 can be used in high-throughput screening assays to identify compounds that can modulate its activity, which can then be further developed into potential drugs.

Furthermore, Recombinant Human WBP2 Protein can be used in diagnostic assays for various diseases. As WBP2 has been implicated in cancer development and DNA damage response, it can serve as a potential biomarker for these conditions. Recombinant WBP2 can be used in diagnostic tests to detect the presence of WBP2 in patient samples, which can aid in early detection and treatment of these diseases.

Conclusion

In conclusion, Recombinant Human WBP2 Protein is a versatile protein with a unique structure and activity. It plays an important role in various cellular processes, including transcription, signaling, and DNA damage response. Recombinant WBP2 has a wide range of applications in research, drug discovery, and diagnostics. Further studies on WBP2 and its interactions with other proteins may uncover new insights into its role in cellular processes and potential therapeutic applications.

Recombinant Human WBP2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human WBP2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products