Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human VDAC2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P45880
Molecular weight:
30.11 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Gly36–Ala294
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human VDAC2 Protein, N-His

Product name ARO-P12363-100
Uniprot ID P45880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Molecular weight 30.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly36-Ala294
Aliases /Synonyms Outer mitochondrial membrane protein porin 2, Voltage-dependent anion-selective channel protein 2, VDAC2, hVDAC2, VDAC-2
Reference ARO-P12363
Note For research use only.
Molecular Constructor
Gly36–Ala294
Product name ARO-P12363-1MG
Uniprot ID P45880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Molecular weight 30.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly36-Ala294
Aliases /Synonyms Outer mitochondrial membrane protein porin 2, Voltage-dependent anion-selective channel protein 2, VDAC2, hVDAC2, VDAC-2
Reference ARO-P12363
Note For research use only.
Molecular Constructor
Gly36–Ala294
Product name ARO-P12363-50
Uniprot ID P45880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Molecular weight 30.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly36-Ala294
Aliases /Synonyms Outer mitochondrial membrane protein porin 2, Voltage-dependent anion-selective channel protein 2, VDAC2, hVDAC2, VDAC-2
Reference ARO-P12363
Note For research use only.
Molecular Constructor
Gly36–Ala294

Introduction to Recombinant Human VDAC2 Protein

Recombinant Human VDAC2 Protein is a type of recombinant protein that is commonly used in scientific research and biotechnology. This protein is a member of the voltage-dependent anion channel (VDAC) family, which are transmembrane proteins that are involved in regulating ion and metabolite transport across the mitochondrial membrane. VDAC2 is a highly conserved protein found in all eukaryotic organisms, and its structure and function have been extensively studied due to its importance in cellular metabolism and apoptosis.

Structure of Recombinant Human VDAC2 Protein

Recombinant Human VDAC2 Protein is a 32-kDa protein that consists of 282 amino acids. It is composed of three beta-barrel transmembrane domains, with the N- and C-termini located on the cytosolic side of the mitochondrial membrane. The protein also contains six alpha-helices that are involved in forming the channel pore. VDAC2 is highly homologous to other VDAC family members, with VDAC1 and VDAC3 sharing 70% and 74% sequence identity, respectively.

Activity of Recombinant Human VDAC2 Protein

Recombinant Human VDAC2 Protein is primarily known for its role in regulating metabolite and ion transport across the mitochondrial membrane. It forms a channel that allows the passage of small molecules, such as ATP, ADP, and pyruvate, between the cytosol and the mitochondrial matrix. This channel is also permeable to ions, such as calcium and potassium, which play important roles in cellular metabolism and signaling.

In addition to its transport activity, VDAC2 has been shown to be involved in several other cellular processes. It has been implicated in the regulation of mitochondrial membrane potential, which is important for ATP production and cell survival. VDAC2 has also been linked to the release of cytochrome c from the mitochondria, a key step in the initiation of apoptosis.

Application of Recombinant Human VDAC2 Protein

Recombinant Human VDAC2 Protein has a wide range of applications in both basic research and biotechnology. Its function in regulating metabolite and ion transport makes it a valuable tool for studying mitochondrial metabolism and cellular signaling. By modulating the activity of VDAC2, researchers can gain insights into the role of this protein in various cellular processes.

In biotechnology, Recombinant Human VDAC2 Protein is used in drug discovery and development. Its involvement in apoptosis makes it a potential target for anti-cancer therapies. By studying the structure and function of VDAC2, researchers can identify potential compounds that can modulate its activity and potentially inhibit cancer cell growth.

Furthermore, Recombinant Human VDAC2 Protein is also used in the production of antibodies for diagnostic and therapeutic purposes. It is a common antigen used to generate specific antibodies that can be used to detect the presence of VDAC2 in various tissues and cell types. These antibodies can also be used to target VDAC2 in cancer cells, potentially leading to targeted therapies.

Conclusion

In summary, Recombinant Human VDAC2 Protein is a highly conserved transmembrane protein that plays important roles in regulating metabolite and ion transport, mitochondrial membrane potential, and apoptosis. Its structure and function have been extensively studied, and it has a wide range of applications in basic research and biotechnology. With its potential as a drug target and its use in antibody production, Recombinant Human VDAC2 Protein continues to be an important protein in the scientific community.

Recombinant Human VDAC2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human VDAC2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products