Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human VASN, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6EMK4
Molecular weight:
38.18 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points
Pro25–Cys349
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human VASN, N-His

Product name ARO-P13296-100
Uniprot ID Q6EMK4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNSLLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRGLTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC
Molecular weight 38.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro25-Cys349
Aliases /Synonyms SLITL2, VASN, Vasorin, Protein slit-like 2
Reference ARO-P13296
Note For research use only.
Molecular Constructor
Pro25–Cys349
Product name ARO-P13296-1MG
Uniprot ID Q6EMK4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNSLLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRGLTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC
Molecular weight 38.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro25-Cys349
Aliases /Synonyms SLITL2, VASN, Vasorin, Protein slit-like 2
Reference ARO-P13296
Note For research use only.
Molecular Constructor
Pro25–Cys349
Product name ARO-P13296-50
Uniprot ID Q6EMK4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNSLLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRGLTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC
Molecular weight 38.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro25-Cys349
Aliases /Synonyms SLITL2, VASN, Vasorin, Protein slit-like 2
Reference ARO-P13296
Note For research use only.
Molecular Constructor
Pro25–Cys349

Introduction

Recombinant Human VASN (Vascular Adhesion Protein-1) is a glycoprotein that plays a crucial role in the regulation of leukocyte recruitment and inflammation. It is a member of the immunoglobulin superfamily and is expressed on endothelial cells, platelets, and leukocytes. Recombinant Human VASN is produced through recombinant DNA technology and has a wide range of applications in both research and clinical settings.

Structure of Recombinant Human VASN

Recombinant Human VASN is a 140 kDa glycoprotein with a complex structure consisting of an extracellular region, a transmembrane domain, and a cytoplasmic tail. The extracellular region contains six immunoglobulin-like domains, which are responsible for the protein’s binding activity. The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic tail contains signaling motifs that regulate cellular processes.

Activity of Recombinant Human VASN

Recombinant Human VASN plays a crucial role in leukocyte recruitment and inflammation. It acts as an adhesion molecule, mediating the interaction between leukocytes and endothelial cells. This interaction is essential for the recruitment of leukocytes to sites of inflammation and infection. Recombinant Human VASN also plays a role in leukocyte transmigration through the endothelium, a critical step in the inflammatory response.

Moreover, Recombinant Human VASN has been shown to modulate the activity of leukocytes. It can induce the production of pro-inflammatory cytokines and chemokines, as well as activate leukocytes to release reactive oxygen species. This activity makes Recombinant Human VASN an important regulator of the immune response.

Applications of Recombinant Human VASN

Recombinant Human VASN has a wide range of applications in both research and clinical settings. In research, it is used as a tool to study leukocyte recruitment and inflammation. Recombinant Human VASN can be used to investigate the role of adhesion molecules in various disease states, such as autoimmune disorders and cancer.

In clinical settings, Recombinant Human VASN has potential as a therapeutic agent. It has been shown to be involved in the pathogenesis of several diseases, making it a potential target for drug development. Additionally, Recombinant Human VASN can be used as a biomarker for various inflammatory conditions, providing a non-invasive method for disease diagnosis and monitoring.

Recombinant Human VASN as a Recombinant Protein

Recombinant Human VASN is produced through recombinant DNA technology, making it a recombinant protein. This technology involves inserting the gene encoding for VASN into a suitable expression system, such as bacteria or mammalian cells. The protein is then produced in large quantities and purified for use in research and clinical applications.

Antigenic Properties of Recombinant Human VASN

Recombinant Human VASN is an antigenic protein, meaning it can elicit an immune response in the body. This property makes it useful in the development of vaccines and immunotherapies. Recombinant Human VASN can be used as an antigen in vaccine formulations to induce an immune response against specific diseases, such as cancer. It can also be used as a target for immunotherapies, where the immune system is harnessed to target and eliminate cancer cells.

Conclusion

In summary, Recombinant Human VASN is a glycoprotein with a complex structure and a wide range of activities. It plays a crucial role in leukocyte recruitment and inflammation and has potential applications in both research and clinical settings. As a recombinant protein, it can be produced in large quantities for various purposes, including as an antigen for vaccine development. The diverse properties of Recombinant Human VASN make it a valuable tool in the study and treatment of various diseases.

Recombinant Human VASN, N-His

There are no reviews yet.

Be the first to review “Recombinant Human VASN, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products