Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human UBE2I/UBC9, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P63279
Molecular weight:
16.73 kDa

Original price was: €290.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
His Asp33–Ser158
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human UBE2I/UBC9, N-His

Product name ARO-P13567-100
Uniprot ID P63279
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
Molecular weight 16.73 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp33-Ser158
Aliases /Synonyms UBE2I, UBC9, p18, UBCE9, Ubiquitin carrier protein 9, RING-type E3 SUMO transferase UBC9, SUMO-conjugating enzyme UBC9, Ubiquitin carrier protein I, Ubiquitin-protein ligase I, Ubiquitin-conjugating enzyme E2 I, SUMO-protein ligase
Reference ARO-P13567
Note For research use only.
Molecular Constructor
His Asp33–Ser158
Product name ARO-P13567-1MG
Uniprot ID P63279
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
Molecular weight 16.73 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp33-Ser158
Aliases /Synonyms UBE2I, UBC9, p18, UBCE9, Ubiquitin carrier protein 9, RING-type E3 SUMO transferase UBC9, SUMO-conjugating enzyme UBC9, Ubiquitin carrier protein I, Ubiquitin-protein ligase I, Ubiquitin-conjugating enzyme E2 I, SUMO-protein ligase
Reference ARO-P13567
Note For research use only.
Molecular Constructor
His Asp33–Ser158
Product name ARO-P13567-50
Uniprot ID P63279
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
Molecular weight 16.73 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp33-Ser158
Aliases /Synonyms UBE2I, UBC9, p18, UBCE9, Ubiquitin carrier protein 9, RING-type E3 SUMO transferase UBC9, SUMO-conjugating enzyme UBC9, Ubiquitin carrier protein I, Ubiquitin-protein ligase I, Ubiquitin-conjugating enzyme E2 I, SUMO-protein ligase
Reference ARO-P13567
Note For research use only.
Molecular Constructor
His Asp33–Ser158

Introduction

Recombinant Human UBE2I/UBC9 is a protein that plays a crucial role in the process of protein modification and degradation. It is a member of the ubiquitin-conjugating enzyme family and is involved in the attachment of the small protein ubiquitin to target proteins, a process known as ubiquitination. This protein has gained significant interest in the scientific community due to its diverse functions and potential applications in various fields.

Structure of Recombinant Human UBE2I/UBC9

Recombinant Human UBE2I/UBC9 is a 17-kDa protein that consists of 158 amino acids. It has a conserved catalytic domain at the N-terminus, which is responsible for its enzymatic activity. The C-terminus of the protein contains a highly flexible tail that allows for interaction with various binding partners.

Enzymatic Activity of Recombinant Human UBE2I/UBC9

The main function of Recombinant Human UBE2I/UBC9 is to catalyze the transfer of ubiquitin from the E1 activating enzyme to the target protein. This process involves the formation of a thioester bond between the catalytic cysteine residue of UBE2I/UBC9 and the C-terminus of ubiquitin. This is followed by the transfer of ubiquitin to the target protein, which is facilitated by the interaction between the flexible tail of UBE2I/UBC9 and the target protein.

Role of Recombinant Human UBE2I/UBC9 in Protein Modification

The ubiquitination process is a crucial mechanism for regulating protein activity, stability, and localization. Recombinant Human UBE2I/UBC9 is involved in various types of ubiquitination, including monoubiquitination, multi-monoubiquitination, and polyubiquitination. These different forms of ubiquitination have distinct effects on the target proteins, such as altering their function, promoting their degradation, or targeting them for specific cellular processes.

Applications of Recombinant Human UBE2I/UBC9

The diverse functions of Recombinant Human UBE2I/UBC9 make it a valuable tool in various research fields. One of its main applications is in studying the ubiquitination process and its role in protein regulation. Recombinant Human UBE2I/UBC9 can be used to investigate the effects of ubiquitination on specific target proteins and to identify potential binding partners.

In addition, Recombinant Human UBE2I/UBC9 has potential therapeutic applications. Dysregulation of the ubiquitination process has been linked to various diseases, including cancer and neurodegenerative disorders. By targeting Recombinant Human UBE2I/UBC9, it may be possible to modulate the ubiquitination of specific proteins and potentially treat these diseases.

Furthermore, Recombinant Human UBE2I/UBC9 has been used in the development of diagnostic tools. Its ability to specifically interact with target proteins makes it a useful tool for detecting and quantifying specific antigens in biological samples. This has potential applications in disease diagnosis and monitoring.

Conclusion

Recombinant Human UBE2I/UBC9 is a crucial protein involved in the ubiquitination process. Its structure and enzymatic activity make it a valuable tool for studying protein modification and regulation. Its potential applications in research, therapy, and diagnostics make it a highly sought-after protein in the scientific community. Further studies and developments in this field may lead to new insights and potential treatments for various diseases.

Recombinant Human UBE2I/UBC9, N-His

There are no reviews yet.

Be the first to review “Recombinant Human UBE2I/UBC9, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products