Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human UBASH3B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TF42
Molecular weight:
29.94 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Gln382–Asp626
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human UBASH3B Protein, N-His

Product name ARO-P10719-100
Uniprot ID Q8TF42
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLT
Molecular weight 29.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln382-Asp626
Aliases /Synonyms Tyrosine-protein phosphatase STS1/TULA2, TULA-2, STS1, Suppressor of T-cell receptor signaling 1, Ubiquitin-associated and SH3 domain-containing protein B, Cbl-interacting protein p70, STS-1, T-cell ubiquitin ligand 2, KIAA1959, UBASH3B
Reference ARO-P10719
Note For research use only.
Molecular Constructor
Gln382–Asp626
Product name ARO-P10719-1MG
Uniprot ID Q8TF42
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLT
Molecular weight 29.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln382-Asp626
Aliases /Synonyms Tyrosine-protein phosphatase STS1/TULA2, TULA-2, STS1, Suppressor of T-cell receptor signaling 1, Ubiquitin-associated and SH3 domain-containing protein B, Cbl-interacting protein p70, STS-1, T-cell ubiquitin ligand 2, KIAA1959, UBASH3B
Reference ARO-P10719
Note For research use only.
Molecular Constructor
Gln382–Asp626
Product name ARO-P10719-50
Uniprot ID Q8TF42
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLT
Molecular weight 29.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln382-Asp626
Aliases /Synonyms Tyrosine-protein phosphatase STS1/TULA2, TULA-2, STS1, Suppressor of T-cell receptor signaling 1, Ubiquitin-associated and SH3 domain-containing protein B, Cbl-interacting protein p70, STS-1, T-cell ubiquitin ligand 2, KIAA1959, UBASH3B
Reference ARO-P10719
Note For research use only.
Molecular Constructor
Gln382–Asp626

Introduction to Recombinant Human UBASH3B Protein

Recombinant Human UBASH3B Protein is a highly versatile protein that has gained significant attention in the field of biological research. This protein is a member of the ubiquitin-associated and SH3 domain-containing family of proteins and is encoded by the UBASH3B gene. It is involved in various cellular processes such as signal transduction, cell proliferation, and immune response, making it a crucial protein in maintaining cellular homeostasis. In this article, we will delve deeper into the structure, activity, and potential applications of Recombinant Human UBASH3B Protein.

Structure of Recombinant Human UBASH3B Protein

The Recombinant Human UBASH3B Protein is a 60 kDa protein consisting of 532 amino acids. It contains a conserved C-terminal ubiquitin-associated (UBA) domain and an N-terminal Src homology 3 (SH3) domain. The UBA domain is responsible for binding to ubiquitin, a small regulatory protein that plays a crucial role in protein degradation and various other cellular processes. The SH3 domain, on the other hand, is involved in protein-protein interactions and plays a role in signal transduction pathways.

The crystal structure of Recombinant Human UBASH3B Protein has been determined, revealing a compact globular shape with a central β-sheet surrounded by several α-helices. This structure is highly conserved across different species, indicating the critical role of this protein in cellular functions.

Activity of Recombinant Human UBASH3B Protein

Recombinant Human UBASH3B Protein is a multifunctional protein that is involved in various cellular processes. It has been shown to regulate the activity of several signaling pathways, including the PI3K/AKT and MAPK pathways, by dephosphorylating key signaling molecules. This protein also plays a role in regulating the immune response by modulating the activity of T-cells and B-cells.

Furthermore, Recombinant Human UBASH3B Protein has been shown to have a tumor-suppressive function. It inhibits cell proliferation and induces cell cycle arrest in cancer cells, making it a potential therapeutic target for cancer treatment. Studies have also shown that this protein is downregulated in various types of cancer, indicating its role in tumor suppression.

Applications of Recombinant Human UBASH3B Protein

The unique structure and activity of Recombinant Human UBASH3B Protein make it a valuable tool in various research applications. It can be used for in vitro studies to investigate its role in different signaling pathways and cellular processes. This protein can also be used for in vivo studies to understand its function in a more physiological setting.

Moreover, Recombinant Human UBASH3B Protein has potential therapeutic applications. As mentioned earlier, it has been shown to have a tumor-suppressive function, making it a potential target for cancer treatment. It can also be used in drug discovery and development to identify small molecules that can modulate its activity and potentially treat diseases associated with its dysregulation.

In addition, Recombinant Human UBASH3B Protein can be used as an antigen in the development of diagnostic assays for various diseases. Its role in regulating the immune response makes it a potential biomarker for autoimmune diseases, and its downregulation in cancer makes it a potential biomarker for cancer diagnosis.

Conclusion

In summary, Recombinant Human UBASH3B Protein is a highly versatile protein with a unique structure and activity. It plays a crucial role in various cellular processes, and its dysregulation has been linked to several diseases, making it a potential therapeutic target and biomarker. With ongoing research, we can expect to discover more about the functions and applications of this protein, further expanding our understanding of its role in maintaining cellular homeostasis.

Recombinant Human UBASH3B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human UBASH3B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products